7EIV


Conserved Protein Domain Family
tRNA_synt_2f

?
pfam02092: tRNA_synt_2f 
Click on image for an interactive view with Cn3D
Glycyl-tRNA synthetase beta subunit
Statistics
?
PSSM-Id: 460442
Aligned: 420 rows
Threshold Bit Score: 520.035
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
7EIV_C         6 FLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVANLAEAQPDREIEKRGPaiaq-afdAE 84 
Q2GD15         4 FLLEILSEEMPVALQSYAQKSFFDLFSSATKDL--SVGKIEVFTSCRRIAVLIDDVKSDLVNQKVDKKGPsv-----gSD 76  Neorickettsia s...
Q2GI76         5 LLFECLSEETPPEMQSSAYAYMDSYIRKELSRCNISFESVKVFVTSNRLTLYVKNIINNLSNNTLKIKGPkv-----sAD 79  Ehrlichia chaff...
WP_010268989   5 LILEVLCEQLPTKTIKSAHEYILPRIDKEFSSRRISCDAPKVFATSHRIILIACNVSQNSSDGKKEIKGPri-----sSD 79  Anaplasma margi...
Q2GLV0         5 LVFEILCEQMPSKMMDIALGYLKNTICSGFSKFAIESRNSRTLVSANRICFIAEGLEQGNSTENKEIKGPrv-----sSS 79  Anaplasma phago...
WP_011944574   6 LILELYSEEIPAKMQKKAELAFQEIFTKNFKLANISFNHLKVYIGPCRVVLHTVFSSKELAAKAIEHKGP--------KV 77  Orientia tsutsu...
Q4FN01         4 FFIELFSEEIPAGLQSNSRNVLLENFQNLFEEKKILFKKSSSFSTPNRLIILFEGLSKEIIQKAEEIKGPnv-------- 75  Candidatus Pela...
P57235         6 LLIEIGTEELPARLLSKISLYFYKNFIKELDFHNISYKNIKYFSTPRRLALKIKDIDITERFVEIKKRGPsiin-sydKD 84  Buchnera aphidi...
Q8D1W2         5 FLIEIGTEELPSYCLNKISKSFCESIKKQLFLSKIEYKNIKWLSSSRRLAVQADLYIYKTKNSYILKKGPriknekdiYN 84  Wigglesworthia ...
P59573         5 FLIEIETEELPPKSLKAIAQSFNKQIIEKSKTYYLKYKQTKWFATPRRIAVMILDINTSDTNFYLQTKGPsikn-afdKL 83  Buchnera aphidi...
7EIV_C        85 GKPSKAAEGWARGCGITVD-QAERltTdK-GEWLLYRAHV-KGESTEALLPNXVATSLAKLPIPKLXRWGASDVHFVRPV 161
Q2GD15        77 L---SVVERFATSMGASTA-DLYLksI-GnKEYYFAPVAG-KVLHIDDIMRQRTEAILRSFSWPRSMRWGNYSLNWIRPI 150 Neorickettsia s...
Q2GI76        80 K---IAIEGFLKKVNKNFS-DLITckI-GnDDFYYAELNHnEETNTEHIILSIIENMLNNFPWDKKMRWGGGKTYWVRPI 154 Ehrlichia chaff...
WP_010268989  80 K---EVISGFLRKVGKSGVeELEIreV-SgEKFYYS-SSVlSSKDLTNELTEVIQCMIENFPLHKRMRWGTGTGYWVRPV 154 Anaplasma margi...
Q2GLV0        80 Q---ESIAGFLRKVGKSEVgELEVrnI-GgVEFYYSVRESvGVNNLNEKVCEILQDAVDNFPLHKRMKWGCGIGEWVRPV 155 Anaplasma phago...
WP_011944574  78 GAKKSAVEGFCKAKSILSK-DLTIktF-NnQQFYVYTHVT-PTQPIKDLLPEIILNSIKEYTWPKSMKWGNYQINWVRPL 154 Orientia tsutsu...
Q4FN01        76 kAPEKAIEGFLRSNQIEKK-DLLKktL-EkGEFYFFKKAS-SKINTIDLLQEYTPIILDKLQWKKSMTWGNYNLSWARPL 152 Candidatus Pela...
P57235        85 GFLTEAATRWLKHCGININ-QAIRlkN-EkGEWLFYKTRK-KQENIESLIPKITESALKNISIKKSMRWGQDNQKFSRPI 161 Buchnera aphidi...
Q8D1W2        85 ----INVKMWIKKFGISTK-QIKLikN-KkGVWVSYKACN-KKYNLFNKLFDIIKSSLEEVYVPKKMKWSNYNFQFIRPV 157 Wigglesworthia ...
P59573        84 GNPTSIMKFWMQKMNIKIH-EITYlnT-NkGSWVTCSKIT-NKKSIQEILIELCRLAIKNISIPTFMKWSNNDIQFSRPV 160 Buchnera aphidi...
7EIV_C       162 HTVTLLLGDKVIPATILG----IQSDRVIRGH-RFXG---EPEFT---I-DNADQYPEILRERgKVIADYEERKAKIKAD 229
Q2GD15       151 KSIVCMLGKSIIPVQFHH----YTAGAITVGPyvd------paLQkikI-TSAEEYQSILMKG-GVILSQIERENLIKEQ 218 Neorickettsia s...
Q2GI76       155 LNIMCILDGKVLPIKFAD----IEANNKSCGN-RFTN------KEffeV-ADFNSYNSKLKKN-NVILCQKERLNFILHQ 221 Ehrlichia chaff...
WP_010268989 155 INVLCVLDGKVLPVSVAG----ITANNRTFGNlRFSNr--KYT-----V-TKAAEYLNFLSEN-MVIVDVEARRKHILEQ 221 Anaplasma margi...
Q2GLV0       156 LNVACVLGGEVVPVTVAG----SKANNITYGNiRFAKt--PHT-----I-NGVDSYLSFLSEN-MVMLDHEERRRSILRQ 222 Anaplasma phago...
WP_011944574 155 RNILCMFNGEELKISWHH----LTSNNKSFGH-KFMS---PNSFT---V-STWKDYTNNLRDN-FVILDRSERQAIILNS 221 Orientia tsutsu...
Q4FN01       153 KSILAVFDDKSLNFKFHH----LIASNSTFID-KEFE---DKKKI---F-KNFKSYKDFFSQS-GIIIDHVLRKEFIVKE 219 Candidatus Pela...
P57235       162 RNIVILLDKKVIP----GdvfnITSKNLLQNH----LsskDSQIK---I-KDAKDYPKILLEKnNIIADYFIRKEKIIED 229 Buchnera aphidi...
Q8D1W2       158 HSITALLDDKIIP----GkifdINIDRNLLGI-FYK-------KRqkiVlNNAVDYENALLKNfNIIVDYKKRKNIINEK 225 Wigglesworthia ...
P59573       161 RNVIMLLNHEIIRNNVLG----LETNRLLSGH-KFM-------TNnkiIlNHAYQYPELLLNSgKVIADYDARKHKIQKH 228 Buchnera aphidi...
7EIV_C       230 AEEAAR-KIG--GNADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTXKGDQKYFPVYan-dGKLLPNFIFVA 305
Q2GD15       219 ISQLEAeH-G--FSVCVTEELLNEVVGITESPNVLLGSFPQSFLELHERIIETVIVSHQKVFPVSk--nGKLLNKFVFVS 293 Neorickettsia s...
Q2GI76       222 IKSITEeS-N--LICEDNQKLINKLNGTLEYPIVIMGSVDEKFSELPKELILSVMHNHQKYLAVFk---EDKITNFITIS 295 Ehrlichia chaff...
WP_010268989 222 LNEQISgT-E--LTYDQNAQILEDMSSNLEYPKVLIGSVDKNFSEIPTEVVSCVMTNHQRYLAIKd--qSGKIVKFASAA 296 Anaplasma margi...
Q2GLV0       223 LDEQIAgT-L--LKYDVHDKIIEELNGMLEYPKVLLGSVDEKFMSLPREVVACVLTKHQRCLAIYd--sSGRIVKFASVA 297 Anaplasma phago...
WP_011944574 222 LEKTCQtL-G--ITLNYNNKLLDEVTGLVEYPIVLYGTIPNEFLSLPEEIIITSVQTHQKYFTTKdh-sNKLAPYFLFVT 297 Orientia tsutsu...
Q4FN01       220 IEKISR-KNN--FIVEPNNKLLDEVTDIVEQPNILVCKFDQKFLNIPKEILIITMQYHQKYFPTFdk-kGKITNEFLVVA 295 Candidatus Pela...
P57235       230 IENIA--K-KikGFIKKNNVLIEEVTALVESPKALLVNFQEKFLQIPKKILINTIEKKQKCFPIYns-eKKLLPYFIFIS 305 Buchnera aphidi...
Q8D1W2       226 IKLEEK---KfkGKVLKNDKFLEEITSLVEIPNIISGNFKKSFLKIPVKIIENILCNIQKCFPVYeknkQNLLPKFIFVI 302 Wigglesworthia ...
P59573       229 ASIAA--Q-SvnGILKIKTTLLEEITALVEWPTILLATFKKRFLNLPQEILVHIIEKKQRCLPIYstnnGTILNSFVVVS 305 Buchnera aphidi...
7EIV_C       306 NIESKDPQQIISGNEKVVRPRLADAEFFFNTDRKKRLEDNLPRLQTVLFQQQLGTLRDKTDRIQA----LAGWIAe---- 377
Q2GD15       294 SI---AGDAPIRGYERVITARLADAASMVLIDSKNPLRELSPKLKQLIFHKKLGSFSEKVQRVRA----LAKFIAfwvpn 366 Neorickettsia s...
Q2GI76       296 TI---SNDNIIKGHNNILNARLLDASFLVKKDKEYNIDYYIEKLKQIVFHAKLGSVFEKVNRIIA----LSKYISiwiph 368 Ehrlichia chaff...
WP_010268989 297 SV---VNNMVIKNHEKVLRARLSDALFLIKKDKEHNMDYYVGLLSGVVFKSGLGTLLDKAERISA----LAKYCSvwipr 369 Anaplasma margi...
Q2GLV0       298 SV---INERVIKIHEMVLRARLSDAMFLIEKDKQYGLDRYREQLANIVFKRDLGSVLDKVNRISA----LAKYASvwvpr 370 Anaplasma phago...
WP_011944574 298 NINTEDYSNIIKGNEKVLSSRLTDAIYFFNQDCQLTLLSKLEKLKKVVFHTKIGSIFDKVQRIKK----ICHKLApd--- 370 Orientia tsutsu...
Q4FN01       296 NNn-DEKGYIKMGNERVVEARLSDAQFFWEKNKSQNLVKQVSKLKNMNYFKGLGSYFDKIQRMRKlggiISDELLis--- 371 Candidatus Pela...
P57235       306 NIQTQESEKIIIGNQRVMHARLSDAEFFFKNDRKVKLESRLLSLKKVLFQNNLGSLYEKTLRIKL----LIKWIAkysss 381 Buchnera aphidi...
Q8D1W2       303 NGNKNGVERIIKDNENVINNRLLDVEFFIKIDLQTKLKDRICKLNSIIFHDNLGSLKEKTIRIKL----LSICISnkin- 377 Wigglesworthia ...
P59573       306 NIETSYPNNIVRGNERVIHAQFVDAEFFFKKDTKKKLIDYKPLLKKIIFHDTLGTLLDKTHRIKK----LITWISkftha 381 Buchnera aphidi...
7EIV_C       378 ----QigAdvnhA-TRAGLLSKCDLXTNXVFEFTDTQGVXGXHYARHDGEAE-DVAVALNEQYQPRFAGDDLPSNPVACA 451
Q2GD15       367 asiiKv--------EEAAKLAKLDLLTTFVRDFPKLAGFMGSHCLSLCGETDvEIIDAVRDHYLPVDAADICPTAPVTVT 438 Neorickettsia s...
Q2GI76       369 ssliKv--------ERAAKLSKFDLSTLAIKEFPELQGIMGGYYASYFNESL-EISESIVNHYEPTNPQKECPSSPISIA 439 Ehrlichia chaff...
WP_010268989 370 ssmlNt--------ERAAMISKADLATLVVREFPELQGKIGRYYAKHSGEEE-EVCVAIEEHYLPIGQKDHCPKSPIGIA 440 Anaplasma margi...
Q2GLV0       371 ahmlEv--------ERASLLSKADLASLMVKEFPELQGKMGRYYAQHAGEES-AVCDALEEHYLPSSQQDRCPSSPVGIA 441 Anaplasma phago...
WP_011944574 371 -----dqE----L-AIAAELCKSDLVSEVVQEFPNLQGIMGKYYALNDKLSP-AVANIIGNHYYPTRIEDEVPNGKAAI- 438 Orientia tsutsu...
Q4FN01       372 -----kdQ----V-ELSASICKVDLVSDIVGEFPELQGIMGGHFAEVQGFDK-EIALAISEHYQPVGLDSKTPKKPFSIA 440 Candidatus Pela...
P57235       382 dvedS---------IRAALLSKCDLVTDVVCEFPELQGKIGMYYALEDKEKK-DVATALEEQYLPRFSGDKLPCTPIGCG 451 Buchnera aphidi...
Q8D1W2       378 ----gnyK----YvSRASLLCKCDLTTNMVFEFPTTQGIIGEYYSEINMESK-EVSLAQREHYYPRFSKDILPTNLTSQI 448 Wigglesworthia ...
P59573       382 nvndC---------IRAADLSKCDLVTNMTFEFPECQGIIGMYYALHDLEPK-NIAIAIKEQYQPKFSKDNLPSNTISYS 451 Buchnera aphidi...
7EIV_C       452 LAIADKXDTLAGIFGIGQH-PKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTEEAVr--------------LYGDklt 516
Q2GD15       439 LALADKIDTLVGLISVKEK-VTSTRDPLGIRRAAIGVLRIIIENKLDVPLQVFLMKAIdlypsslffslikkiGASS--- 514 Neorickettsia s...
Q2GI76       440 VSISDKIDNLVGMIVAGEQ-VTSSRDPFSMRRMAISIIRIIIENNLNIPIRLLIEKSVslysfaiterttinkLKNV--- 515 Ehrlichia chaff...
WP_010268989 441 VSIADKVDSLVGLMATENI--SGSRDPFALRRTSISLLRVMIENSVSIPLDLMVSKAVsmymck----arlnkN-EG--- 510 Anaplasma margi...
Q2GLV0       442 LSIADKVDTLVGLMATERI--SGSRDPFALRRTAIALLRVIKENCISIPLDLMVSKSVsfylcd----akknkDLKS--- 512 Anaplasma phago...
WP_011944574 439 LALADKLDNLTSLYLAGER-ATSSKDPFALRRCAFSIARIILTNKIQVKLLDLL-------------------TFIY--- 495 Orientia tsutsu...
Q4FN01       441 LALTDKIDTLVGFFGINQK-PTSSKDPYALRRSALGVIKLLIDNNKEFKIKDLISYSTsl--------------hkD--- 502 Candidatus Pela...
P57235       452 LSIADKMDTLSGMFYIGNI-PSSDKDPFALRRLAIGIIRIILEKNIPLNLEDLIKKSLsl-------------------- 510 Buchnera aphidi...
Q8D1W2       449 ISIADKLDTIVGIFGIKLY-PTGKKDPFCLKRLSLGIIRIIIEKKLSININHIIDKSIslysfk---------------- 511 Wigglesworthia ...
P59573       452 LALADKIDTLTGLFSINKNyNISEKDPFSLRRLATGIMRIIIKKNIHINLYDLLEKSLktykki---------------- 515 Buchnera aphidi...
7EIV_C       517 nAN-------VVDDVIDFXLGRFRAWY-QDEGYTVDTIQAVLA 551
Q2GD15       515 -DEekqrkddVVNFTLSFFSERLKALL-FKSGVSQAVFASVSs 555 Neorickettsia sennetsu str. Miyayama
Q2GI76       516 -ISrtnrkkeIISSVIEFFSNRFKIIL-KEDGIKEDIINAVFE 556 Ehrlichia chaffeensis str. Arkansas
WP_010268989 511 -RFlrvdrdaLISTILSFCYDRLKVIL-KESDLDKEVVDAIVg 551 Anaplasma marginale
Q2GLV0       513 -VFrsvdvdcITSLILDFCYERLKIIL-REEGLDRDIVNIVVG 553 Anaplasma phagocytophilum str. HZ
WP_011944574 496 -QLhdiytneLATEVLLFIKDKTKNLL-NAK-FNHLLVEAIFQ 535 Orientia tsutsugamushi
Q4FN01       503 -QGfifsndsSQKELSDFLMDRLKYYM-KEKKIRSEIIEASIK 543 Candidatus Pelagibacter ubique HTCC1062
P57235       511 ynKkneddliLFDKMIKFFMIRLFHWY-EETGYSAKIIKSVLS 552 Buchnera aphidicola str. APS (Acyrthosiphon pisum)
Q8D1W2       512 -----ltnenLKKEVLEFFLKRLISLY-EKK-YNPCIIKSVIS 547 Wigglesworthia glossinidia endosymbiont of Glossina ...
P59573       516 -----nnsdiILKKEIQFLFNRIYSIYdKNK-YNHSIIKSILE 552 Buchnera aphidicola str. Bp (Baizongia pistaciae)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap