2NP1,2AH7


Conserved Protein Domain Family
Nitrophorin

?
pfam02087: Nitrophorin 
Click on image for an interactive view with Cn3D
Nitrophorin
Statistics
?
PSSM-Id: 111029
View PSSM: pfam02087
Aligned: 3 rows
Threshold Bit Score: 278.018
Threshold Setting Gi: 3212694
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2NP1_A   2 CTKNALAQTGFNKDKYFNGdVWYVTDYLDLEPDdVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQEESPG- 80  Rhodnius prolixus
O77000  25 CSTNISPKKGLDKAKYFSG-TWYVTHYLDKDPQ-VTDPYCSSFTPKESGGTVKEALYHFNSKKKTSFYNIGEGKLGSAGv 102 Rhodnius prolixus
2AH7_X   3 CSTNISPKQGLDKAKYFSG-KWYVTHFLDKDPQ-VTDQYCSSFTPRESDGTVKEALYHYNANKKTSFYNIGEGKLESSGl 80  Rhodnius prolixus
2NP1_A  81 KYTANFKKVEKNGNVKVDVTSGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDTNAGDKVKGAVTAASLKF 160 Rhodnius prolixus
O77000 103 QYTAKYNTVDKKRKEIEPADPKDSYTLTVLEADDSSALVHICLREGPKDLGDLYTVLSHQKTGEPSATVKNAVAQAGLKL 182 Rhodnius prolixus
2AH7_X  81 QYTAKYKTVDKKKAVLKEADEKNSYTLTVLEADDSSALVHICLREGSKDLGDLYTVLTHQKDAEPSAKVKSAVTQAGLQL 160 Rhodnius prolixus
2NP1_A 161 SDFISTKDNKCEYDNvSLKSL 181 Rhodnius prolixus
O77000 183 NDFVDTKTLSCTYDD-QFTSM 202 Rhodnius prolixus
2AH7_X 161 SQFVGTKDLGCQYDD-QFTSL 180 Rhodnius prolixus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap