Conserved Protein Domain Family

pfam02077: SURF4 
SURF4 family
PSSM-Id: 111019
Aligned: 6 rows
Threshold Bit Score: 347.848
Threshold Setting Gi: 1723786
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O74559 269 RYDFFQTLSIVGGLLYLVNTGPGKFSVDEKKKIY 302 Schizosaccharomyces pombe 972h-
Q18864 244 KYDFFQTMSVIGGLLLVIAYGPGGVSVDDYKKRW 277 Caenorhabditis elegans
O45731 236 RYDFFQTLSAIGGLLLLIHTGPGEFSFDELKKKW 269 Caenorhabditis elegans
P53337 277 KYEFYQNLSIIGGLLLVTNTGAGELSVDEKKKIY 310 Saccharomyces cerevisiae S288C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap