Conserved Protein Domain Family
Gallidermin

?
pfam02052: Gallidermin 
Gallidermin
Statistics
?
PSSM-Id: 110996
Aligned: 3 rows
Threshold Bit Score: 87.0331
Threshold Setting Gi: 756892052
Created: 19-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O68586   12 TETFDVQEDLFAFDTTDTTIVASNDDPDTRFKSWSLCTPGCARTGSFNSYCC 63  Streptococcus mutans
P08136    1 MEAVKEKNDLFNLDVKVNAKESNDSGAEPRIASKFICTPGCAKTGSFNSYCC 52  Staphylococcus epidermidis
KIR11081  1 MEAVKEKNELFDLDVKVNAKESNDSGAEPRIASKFLCTPGCAKTGSFNSYCC 52  Staphylococcus gallinarum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap