2JP3,2MKV


Conserved Protein Domain Family
ATP1G1_PLM_MAT8

?
pfam02038: ATP1G1_PLM_MAT8 
Click on image for an interactive view with Cn3D
ATP1G1/PLM/MAT8 family
Statistics
?
PSSM-Id: 426576
Aligned: 24 rows
Threshold Bit Score: 52.9864
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JP3_A         5 DKGSPFYYDWESLQLGGLIFGGLLCIAGIALALSGKCKC-RRNHTPSSL 52  Norway rat
1_pfamImport   1 KEHDPFTYDYQSLQIGGLVIAGILFILGILIVLTGEPD-----EEEGTF 44 
XP_015192064  34 NEDNPFKFDYYRLRVGGLILSAVLCLIGITILLSGHCRC-KFKQDKRRR 81  spotted gar
Q14802        25 DKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKC-KFGQKSGHH 72  human
4_pfamImport   1 DKNSPFYYDWHSLQIGGVICAVILCGIGVIVLLSSKCKC-KFSQKPSHR 48 
XP_021585711  25 DKNSPFYYDWYSLRVGGLICAGVLCAIGIIVLMSGKCKC-RFSPKPSHR 72  thirteen-lined ground squirrel
P59645        25 DKDSPFYYDWHSLRVGGLICAGILCALGIIVLMSGKCKC-KFSQKPSHR 72  Norway rat
XP_018890301  25 NKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKC-KSSQKQHSP 72  western lowland gorilla
EHB14009     138 DEDSPFYYDEPTLRKQGLLVAAVLFITGIVILTSKNGIRgKGTKSQRGL 186 naked mole-rat
EHB14010     145 EEFDPFFYDYATVQTVGLTLATIMFLLGIIIIISKKVKCrKADSRSESP 193 naked mole-rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap