4ERV,4ETU,4ERV,4ETV,3J8E,3J8E,3NRT


Conserved Protein Domain Family
RyR

?
pfam02026: RyR 
Click on image for an interactive view with Cn3D
RyR domain
This domain is called RyR for Ryanodine receptor. The domain is found in four copies in the ryanodine receptor. The function of this domain is unknown.
Statistics
?
PSSM-Id: 334793
View PSSM: pfam02026
Aligned: 126 rows
Threshold Bit Score: 96.4117
Threshold Setting Gi: 1133470819
Created: 23-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4ERV_A           5 FDPKPINTMN-----------------------------------FSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKYGI 49
gi 684402673  3418 FIPQPIETSQlyrvltikrchmasvrcpedsksvpsfycvlrmegVHLPNAMKGLIDRFAQHCHDSWALELIEQGYTFGP 3497
gi 576692461  3359 FRPTPLVTSS-----------------------------------IKLPAALSILVDQFAKHCHDTWAQELVDQGYIYGL 3403
gi 195998417  2785 YIPQPVNTVN-----------------------------------VILTDELKHLIHSYACNKHDIWAHKQFTEGWSFGF 2829
gi 961500539  1078 FRPMPLVTST-----------------------------------IKLPAALSILVDQFAKHCHDTWAQELVDQGYVYGM 1122
gi 802712304     1 ------------------------------------------------------MCVKFAEHFHDSWASRKLDKGWVHGE 26
gi 1871447    2837 WIPRTVDVSR-----------------------------------CEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGD 2881
gi 402581161    34 WNPDPVDVSE-----------------------------------VHFDDDLKSVVAKFAEHFHDSWASRKIEKGWNYGE 78
gi 1005949980 2905 YLPNPVNTSG-----------------------------------INLTGGLVNLINRFAEHYHDSWSQRKFEQGWSYGD 2949
gi 762136655   265 YNPQPVDTGR-----------------------------------IKLNQNYDVTINRFAEHFHDCWAIKKIDQGWVFGT 309
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*.
4ERV_A          50 SLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVER 95
gi 684402673  3498 VVDEVKRTHPNLCSFANLQEHEQARYIQPVTDTLKAMFALGWSVDa 3543
gi 576692461  3404 TLDEARRTHPNIRSYHSLSQRDQMRYIQPVTETLRAMLALGWTIDP 3449
gi 195998417  2830 ESDEYDKKDSLLLPYNLLSQKDKYHLNKYMNDCLRTILASGWSITS 2875
gi 961500539  1123 TLDETRRTHPNIRPYHSLSQRDQMRYIQPVTETLRAMLALGWTIDP 1168
gi 802712304    27 IYSRVTNTHPRLKPFSQLRDFEKNFYKERCSECIRAIIAWGFNIEM 72
gi 1871447    2882 LYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEM 2927
gi 402581161    79 LYSRQALTHPRLKPFVFLPDFEKNFYQERCAECLRALLVWNYSIEL 124
gi 1005949980 2950 SWSLERKTHPRLKPYYMLNDYDKEKYKEPITDIIKTLLALSWQLEQ 2995
gi 762136655   310 NYDDERKTHPKLKPYHLLDEESKSKYMSPIKENLKVMLYWGWSLEQ 355
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap