Conserved Protein Domain Family
PPS_PS

?
pfam02006: PPS_PS 
Phosphopantothenate/pantothenate synthetase
This family of archaeal proteins includes pantothenate synthetase from Methanosarcina mazei and 4-phosphopantoate--beta-alanine ligase (phosphopantothenate synthetase) from Pyrococcus kodakaraensis. Pantothenate synthetase catalyzes the condensation of pantoate with beta-alanine in an ATP-dependent and ADP-producing reaction. 4-phosphopantoate--beta-alanine ligase catalyzes the conversion of (R)-4-phosphopantoate and beta-alanine to 4'-phosphopantothenate in the CoA biosynthesis pathway. It cannot use (R)-pantoate as substrate and thus does not display pantothenate synthetase activity.
Statistics
?
PSSM-Id: 426559
Aligned: 76 rows
Threshold Bit Score: 217.735
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Mvol_0285     66 LLLAKNPVISVNGNSIALAKDELIDLATELNGKIEVNLFYRTTEREQKIKEFFEknesnnenyKNNKIILLGI-DDAn-- 142
jgi:Mfer_0656     64 LLLSKNPVISVNGNTAALSAKDVVKLAEVIGGKIEVNLFHRTVKRARKIKKILM---------KAGAKEVLGIdEKL--- 131
NZAGRC:Abm4_0816  64 LLLAEHPVLSVNGNTTALVIDEVIELARATDSKIEINLFYRTEERVDKITKLFK---------DHGYEDILGTnYDDl-- 132
WP_012956024      64 ILLAENPVLSVNGNTTALAIDEIIELAKATDSKIEINLFYRTPERVEIIERMFK---------ERGWEDILGGnDEKl-- 132 Methanobrev...
Q57662            71 LILAENPVISVNGNTVALAIDEVVELAKELNGKIEVNLFYRTKERELAIKRAFEekfk--ddiETGKIKILGI-DDAn-- 145 Methanocald...
jgi:Maeo_0765     64 LLLAENPVISINGNTIALSKHDIVELSEELNGKIEVNLFYRTKEREENIKKAFEedkeiynkiKNKKIKLLGL-DPAttn 142
Q6LXP3            65 LVLAENPVISVNGNSVALAKDEFVELAKELNGKIEVNLFYRTTEREEKIKDVFEs-------dINGGIVLLGI-DNAd-- 134 Methanococc...
CDG65278          66 LLLAKNPVLSINGNTSVLAAEDIVKLAQILPAKVEINLFYRTPQRVMKVEEVLR---------KAGATEILGKeGDDy-- 134
Q2NGU4            64 fLTRKHPVLSVNGNTTALVSEDIAKLSELLDIPVEINLYYRTPERIENIERVYK---------DLGVKEILGTdEDDf-- 132 Methanospha...
jgi:Spith_0200    67 LLTSRHPVVSVNGNVVALCPEELVRLSKVTGAPLEVNLFYRSREREEAIARVLR---------EHGAEQVLGVgAEA--- 134
jgi:Mvol_0285    143 kQMPNVDHLRGKVSEAGIYTADVVLVPLEDGDRAEALVEMGKQVIAIDLNPLSRTAQKSTITIVDELTRCIPLLTEEIIN 222
jgi:Mfer_0656    132 -KHIDVDSNRSTASPHGIYNADTVLVPLEDGDRTEALVKSGKTVIAIDLNPLSRTSQTATISIVDNIVRALPKLYEEVVK 210
NZAGRC:Abm4_0816 133 yYFDKITNPRATASRQGIYVADVILVPLEDGDRAELLKEAGKKIICIDLNPLSRTSKMSDISIVDNVVRAIPEMTRLANE 212
WP_012956024     133 eYIDNLNSPRATASKEGSYIADVMLVPLEDGDRAEVLVQNGKKIICIDLNPLSRTSKMSTVSIVDNIVRAVPLMTSMALD 212 Methanobrev...
Q57662           146 kQIPNLDSLRGKVSEEGIFTADVVLVPLEDGDRAEALVNMGKKVIAIDLNPLSRTARKSTITIVDELTRAMPLLIKYVKE 225 Methanocald...
jgi:Maeo_0765    143 kQIKNLDSLRGKVSEEGIYSADVVLVPLEDGDRTEALVNMGKTVICIDLNPLSRTARKSTITIVDELTRCIPLLTKYVKE 222
Q6LXP3           135 kQIPGIDHLRGKVSESGIYTSDVVLVPLEDGDRAEALVKMGKTVIAIDLNPLSRTARKSTISIIDELTRCIPLITEYVRE 214 Methanococc...
CDG65278         135 lPLEGLEGPRSRAHPEGVYKADVVLVPLEDGDRAEALVALGKTVITIDLNPLSRTAQTSSITIVDNIVRAIPLIIEEINK 214
Q2NGU4           133 iDTPNLNGPRSPVSIEGIKKSDLVFIPLEDGDRAEKLYDLGKDIISVDLNPLSRTAQTSTVTIVDNIVRVIPALIESVKK 212 Methanospha...
jgi:Spith_0200   135 -VIPELSSERRRVDPEGILEADCVFVPLEDGDRTEALVRLGKKVITVDLNPLSRTARTATVTIVDNIVRALPLLIEVIER 213
jgi:Mvol_0285    223 Lkq--kNLSNNELKQI-SEFDNKKALNKVLKLI 252
jgi:Mfer_0656    211 Lk----NKNKEELKEIiEKFDNKKNLEEVLKLI 239
NZAGRC:Abm4_0816 213 Yk----NKDEDFLLKIvNDFNNEENLKDSLDsf 241
WP_012956024     213 FkekgkDKDKEFLENIiKNFSNEQNLKDSLAEI 245 Methanobrevibacter ruminantium
Q57662           226 Fk----NKDREELLKIvEDFDNKKNLKDMIDYI 254 Methanocaldococcus jannaschii DSM 2661
jgi:Maeo_0765    223 Yk----QKDKKELENIvKNYDNNQNLKSILNYI 251
Q6LXP3           215 Yk----KMDRAELLKIvENYDNEENLRNILNLI 243 Methanococcus maripaludis
CDG65278         215 Lk----GCPVDELESIvREFDNKRNIASSLQLi 243
Q2NGU4           213 Ye----NYDKTDIQEKiDLFNNKTNLNIAIKDI 241 Methanosphaera stadtmanae DSM 3091
jgi:Spith_0200   214 H-----RDDPSSLAv--PDYDNKRILAEALSAI 239
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap