Conserved Protein Domain Family
SDH_sah

?
pfam01972: SDH_sah 
Serine dehydrogenase proteinase
This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily. The family has a catalytic triad of Ser, Asp, His residues, which shows an altered residue ordering compared with the ClpP proteinases but similar to that of the carboxypeptidase clan.
Statistics
?
PSSM-Id: 110924
View PSSM: pfam01972
Aligned: 4 rows
Threshold Bit Score: 474.334
Threshold Setting Gi: 2496184
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O66996   1 MPYYDPFSY-LFSLLWFLLFVFILLSPWYKRMALIKAREDVIRKLEEKRKSRVITMIHRQEQIGFLGIPIFRFMTIEDSE 79  Aquifex aeolicus
Q57601   3 GEKMDPLSGfISSLIWWLLFFYLIMAPQIQYKQLQLARLKILRELSNKRNSTVITMIHRQESIGLFGIPVYKFITIEDSE 82  Methanocaldococcus ja...
O29403   7 VTYSDPMAS-LSGLFWILLFLYLIFAPQLKHQQLLAARRRAMRRIGMKRGSNVITMIHRQESIGFLGIPIYRFIDIDDSE 85  Archaeoglobus fulgidus
Q58890   9 KIMGDEMTS--MDMFFFLFIFLLFIYPEMMMRYRIMKRLRCIREIERQRGTRVIAMIHRQEALTFLGIPIYKFITIEDSE 86  Methanocaldococcus ja...
O66996  80 RVLRAIRMTPDDMPIDLIIHTPGGLALAATQIANALVKHKAPVRVIVPHYAMSGGTLIALAADEIIMDENAVLGPVDPQI 159 Aquifex aeolicus
Q57601  83 EILRAIRAAPKDKPIDLIIHTPGGLVLAATQIAKALKAHPAETRVIVPHYAMSGGTLIALAADKIIMDENAVLGPVDPQL 162 Methanocaldococcus ja...
O29403  86 KVLRAIRSTPKDKPIDLIIHTPGGLVLAATQIAKALHDHPAKTTVIVPHYAMSGGTLIALAADEILIDPHAVLGPVDPQL 165 Archaeoglobus fulgidus
Q58890  87 EILRAIRLTPEDMPIDLIIHTPGGLALASEQIALALKEHKAKTTVIIPHYAMSGGSLIALAADEIIMDKNAVMGPVDPQI 166 Methanocaldococcus ja...
O66996 160 GNMPAASILKVLEKKDPKDIDDQTLIMADVSEKAIKQMVDCLVDLLtKNGMDKEKAKKIAEELATGKFTHDYPLTVEYLK 239 Aquifex aeolicus
Q57601 163 GQYPAPSIVKAVEQKGADKADDQTLILADIAKKAINQVQNFVYNLL-KDKYGEEKAKELSKILTEGRWTHDYPITVEEAK 241 Methanocaldococcus ja...
O29403 166 MNYPAPSILKVVEKKEPKDIDDKTLIMADIAEKAINQVRETVFNLL-KDKMDEEKAREVAKILTEGRWTHDYPLTVEELR 244 Archaeoglobus fulgidus
Q58890 167 GQYPAASILEAYYRKG-EKVSDETLILVDISKKAIKQMEEFVYELL-KDKYGDEKAKEIAKKLTSGTWTHDYPLTVSKLK 244 Methanocaldococcus ja...
O66996 240 SLGLPVNTNVPQEVYELMELYEQPMGSQPPsVQYIPVPYKspqQQQNAK 288 Aquifex aeolicus
Q57601 242 ELGLDVDTNVPEEVYTLMELYKQPVRQRGT-VEFMPYPVK---QENGAK 286 Methanocaldococcus jannaschii DSM 2661
O29403 245 QLGLKVSTDVPEEVYELMELYPQPMMQRHPgVEFVPSPPK---GEKPSF 290 Archaeoglobus fulgidus
Q58890 245 ELGIEVNTNVPRKVYELLELYPQPMGAKPS-VYYIPVPYSkkeSEKNAK 292 Methanocaldococcus jannaschii DSM 2661
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap