Conserved Protein Domain Family
Ni_insertion

?
pfam01969: Ni_insertion 
Nickel insertion protein
Members of this family may be involved in the activation of nickel-pincer cofactor-dependent enzymes. LarC from Lactobacillus plantarum is involved, together with LarB and LarE, in the synthesis of the enzyme-bound cofactor of lactate racemase (LarA). Larc C binds Ni2+, and functions in nickel delivery to pyridinium-3,5-bisthiocarboxylic acid mononucleotide (P2TMN), to form the mature cofactor.
Statistics
?
PSSM-Id: 426537
Aligned: 269 rows
Threshold Bit Score: 226.562
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CDD81428         5 LYLETGSGISGDMFVAAMLDLGADQKaLEAALAS-LPVkgfKTEISRVQKSGIDCCDFNVILdaehenndhdmaylygpd 83 
CCQ32902         4 LAFDGRMGASGDMILGALLDAGADPD-VLTPVEDaLGV---EYVVERTTTESIDAASVDVRYsadadvqshghehegeh- 78 
Q18FI2           4 LVFDGRMGASGDMILAALISAGASAD-ALSPVEDaLGI---QYVVNTETKAGILATRVHIVSdpestsaqsnkqstevdg 79  Haloquadratum...
WP_012943347     4 LAFDGRMGASGDMILAALLDAGADPD-VLEAVTDgLAV---EYEIDETVKCGIASTTVD-VFltgdsavdpdghdgdenh 78  Haloterrigena...
jgi:Natpe_1166   4 LAFDGRMGASGDMILAALIDAGADAD-VLEPVTDaLPV---AYRIDDTEKTGIGATTADVVFpdddhahdhdhadgdgah 79 
WP_015322679     4 LAFDGRMGASGDMILAALLDAGADRD-VLEPVETaLDL---EYRIDETVKCGIASTTVDVILtdedaartegdhghvhdh 79  Natronococcus...
WP_049953072     4 LAFDGRMGASGDMLLAALLDAGGDPT-VLEPVEDaLSL---EYRIDETTKCGITATTVDVVLtdyqdetdseaglegvdd 79  Halostagnicol...
WP_013878603    10 LAFDGRMGASGDMLLAALVDAGADPD-ALEAVEAtLEI---EYRIAETVKCGIASTTVDVVLtgesgdssghehehdehs 85  Halopiger xan...
ELY33822         4 LAFDGRMGASGDMILATLLDAGADPD-VLESITDeLDV---AYQIEETVTCGISGTSVDVVLteehdghgecddghghgh 79 
ELY40551         4 vAFDGRTGASGDMILGALLAAGADPA-VLAPVETaLGV---RYEVDGVMKNGISATGVTVsrdrghaeddhr-------- 71 
CDD81428        84 pvvssdvpeehhhhhdeegehhchchedgehhhhhdeegehhchcheegehhhhhdeegehhhhhdeegehhchchedge 163
CCQ32902           --------------------------------------------------------------------------------    
Q18FI2          80 ahqemtasdaheddksqsddshihdt------------------------------------------------------ 105 Haloquadratum...
WP_012943347    79 rtldaddpdrde-------------------------------------------------------------------- 90  Haloterrigena...
jgi:Natpe_1166  80 dhdqshgh------------------------------------------------------------------------ 87 
WP_015322679    80 gdpdhhdrgdp--------------------------------------------------------------------- 90  Natronococcus...
WP_049953072    80 hshggdnndrdgsghshd-------------------------------------------------------------- 97  Halostagnicol...
WP_013878603    86 hqhdghdhs----------------------------------------------------------------------- 94  Halopiger xan...
ELY33822        80 dhdhdhghshshadhshshadht--------------------------------------------------------- 102
ELY40551           --------------------------------------------------------------------------------    
CDD81428       164 hhhhhdeegehhchchedgeehphhhhhdeeehhcphfhgeeghhhhhhdeehhcphfhgeeghhhdhdhvhGHHHHHEH 243
CCQ32902        79 --------------------------------------------------------ghdhgqsdhatqahepTAEGHGPT 102
Q18FI2         106 ------------------------------tendsnththaqnnrqqdtdqnkpthkhvhadghdhshdesvpIEGHGPA 155 Haloquadratum...
WP_012943347    91 -------------------------------------------dsqghdhahehgghghahgdgqsheengvrAEGHGPH 127 Haloterrigena...
jgi:Natpe_1166  88 ------------------------------------------------dhsheqadtegghthetagdgtdtpAEGHGPH 119
WP_015322679    91 ---------------------------------------------dhghvddrgdddhdhghvhdhedapgvpAEGHGPH 125 Natronococcus...
WP_049953072    98 --------------------------------------dnsnghdggshthdgdgnshanhehshdhgddathAEGHGPH 139 Halostagnicol...
WP_013878603    95 ----------------------------------------------rhehdhghddhnhadghssdgdhdhvhAEGHGPH 128 Halopiger xan...
ELY33822       103 --------------------------------hshdedghehthshtdshdhahehthddhehththththtpAEGHGPH 150
ELY40551        72 --------------------------------------------------------------hedgddhahdhVEGHGPH 89 
CDD81428       244 RNLADVMAVIDGASMTDHAREIAKKIFMLIAEAEAKAHNLPIDEVHFHEVGAVDSIVDIISAAVCFDSLGISEVIVPKLS 323
CCQ32902       103 RSYEEVRNVVEGMGLPDAVENRALAIFERLGEAESAVHGTDLDATHFHEVGADDAIADVVGASLLLADLDPEKVVTTPLS 182
Q18FI2         156 RTYREVIEIVERMGLNADVESTAIEIFTRLGTAEAAVHGTSLSATQFHEVGTDDAIADIVGAALLLADMDVDRVCVTPVS 235 Haloquadratum...
WP_012943347   128 RSYQEVCDIVAGMGLEPAVERDALAVFELLGEAEASVHGESIEEIHFHEVGADDAIADVVGAVLLVHDLEPDRIVTTPLA 207 Haloterrigena...
jgi:Natpe_1166 120 RSYREVCEIVQGMDLEPAIEADALAIFELLGEAEAAVHGEDLESIHFHEVGADDAIADVVGAAALLHDLEPDRVVTTPLA 199
WP_015322679   126 RSYLEVREIVEGMELDPAVERDALAIFELLGEAEASVHGEDLAEIHFHEVGADDAIADVVGAAALVDDLEVERVVTTPLA 205 Natronococcus...
WP_049953072   140 RSYLEVCEIVEEMGLDAAVERDALAIFELLGEAEASVHGENLEEIHFHEVGADDAIADVVGAVLLLSDLEPDRVVTTPLA 219 Halostagnicol...
WP_013878603   129 RSYREVREIVADMALPAAVEDDALAIFKRLGEAEASVHGETLEDIHFHEVGADDAIADVVGAAALVHDLEPDRIVTTPLS 208 Halopiger xan...
ELY33822       151 RSYTDVRTIVETMALPDPVERDALAIFKRLGEAEASVHGKALESIHFHEVGADDAIADIVGAAALVHDLAPDRIVTTPLS 230
ELY40551        90 RSYREVCALVESMDLDSAVEERALAVFAVLGEAEASVHGEDLESIHFHEVGADDAIADVVGATLLLSDLGPDRVVTTPLS 169
CDD81428       324 EGTGTVRCQHGRLPVPVPATLNIVTACGMPLeiMDATGEFVTPTGAAIACAL--ATShTLpsLFRIERIGLGAGKRAYtE 401
CCQ32902       183 AGDGEVRMAHGTTTVPAPAVVEIAADAEYSIngGPLERELLTPTGAAILAEVaeGVE-TLp-AMDVTTVGYGAGDHDTgE 260
Q18FI2         236 TGSGEITMSHGSFSVPPPAVVEIAEEATWSLrgGPVNAELLTPTGAAILAHIaeGVQ-TLp-TLTIAATGYGAGGYDFeE 313 Haloquadratum...
WP_012943347   208 TGGGSVSMSHGEYPVPTPAVVEIAERADWSLrgGPVDAELLTPTGAAILGHFadGVD-ALp-SLDLGGVGYGAGGYDLdP 285 Haloterrigena...
jgi:Natpe_1166 200 TGGGTVSMSHGEYPVPTPAVVELAQRADWSLrgGPVDAELLTPTGAAILAHVadGVD-SLp-ALDLESSGYGAGGYDLdP 277
WP_015322679   206 TGGGTVGMSHGEYPVPTPAVVEIAERASWSLrgGPVDTELLTPTGAAILGRLadGVE-SLp-ALELEASGYGAGGYDLdP 283 Natronococcus...
WP_049953072   220 TGGGTVSMSHGRYPVPTPAVVELAERADWSLrgGPVETELLTPTGAAILGHVaeGVD-SLp-SLSLEESGYGAGGYDLdP 297 Halostagnicol...
WP_013878603   209 TGGGTVGMSHGEYPVPTPAVVEIAREADWSLrgGPVDRELLTPTGAAILAHFaeGVD-ELp-SLELEASGYGAGGYDLdP 286 Halopiger xan...
ELY33822       231 TGGGTATMAHGEYPIPAPAVVEIAQEADWALrgGPVEAELLTPTGAAILAHFadGVD-SLp-ELDVTAAGYGAGGYDLdP 308
ELY40551       170 AGGGTVEMSHGTYPVPGPAVVEIARSADWSLrgGPVERELLTPTGAAILAVVadGVG-SVp-DLHVEDVGYGAGTADLdE 247
CDD81428       402 RAGILRALLi---S--DD------------------------QGEGERDEVLKIETDIDDCSGEVLGYTLEKLMQAGALD 452
CCQ32902       261 RANALRVLV----G--ET------------------------TGELRREEIAVLETNVDDASPEMLGALQETLTAVGARD 310
Q18FI2         314 YPNVLRVLIgevptpmgpeasmntdtieanntdrpqpdletdrltLDRESIVVLETNLDDATPEVLGSLQETLTDVGARD 393 Haloquadratum...
WP_012943347   286 HPNVLRALV----G--DA------------------------QGELVKDDIAVLETNLDDATPEVLGGLQETLANAGARD 335 Haloterrigena...
jgi:Natpe_1166 278 HPNVLRTLV----G--TG------------------------EGTLVKDDIAVLETNLDDATPEVLGGLQETLADAGARD 327
WP_015322679   284 HPNVLRTLV----G--DG------------------------GREFLKDDIAVLETNLDDATPEVLGGLQETLSDAGARD 333 Natronococcus...
WP_049953072   298 HPNVLRALV----GeaDA------------------------AGPLVRDDITVLETNLDDATPEVLGGLQETLTEAGARD 349 Halostagnicol...
WP_013878603   287 HPNVLRALV----G--RG------------------------DGSLVKDDIAVLETNLDDATPEVLGGLQETLSDAGARD 336 Halopiger xan...
ELY33822       309 HPNVLRVLV----G--EG------------------------AGGLYKDNIAVLETNLDDATPEILGSLQETLAEVGARD 358
ELY40551       248 HPNVLRATVgtsrA--DH------------------------ADHAGHEGITVLETNVDDVSPEILGGLQETLTDAGARD 301
CDD81428       453 VHYAPVFMKKNRPAWELTVICKKEIRETLEDIIFRETTTIGVREFPsVMRVILKREEREVETPFG----QALVKQV--IF 526
CCQ32902       311 VSILPATMKKSRPGHLIKVVVKPADADRVARRLAEETGTLGIREHGaGHRWVAERETRTVDLVIDgetyAVDVKIAsdRE 390
Q18FI2         394 VTIVPTSMKKSRPGHLIKVITKPDDASSVAQRLAVETGTLGIREHPaRHRWRANRTSETVTLTINdnsyEIAVKIGrdAD 473 Haloquadratum...
WP_012943347   336 VSILPVTMKKSRPGHLVKVICKPADRQRVARALAEETGTLGVRDAGaTHRWIANRSFETVELEVDggtsEVTVKIAsdAD 415 Haloterrigena...
jgi:Natpe_1166 328 VSILPATMKKSRPGHLVKVICKPADRERVARALAEETGTLGVRDAGaTHRWIAEREFETVCLEVDgdeyEVTVKIAsgAD 407
WP_015322679   334 VSIVPATMKKSRPGHLVKVICKPEDRERVARALAEETGTLGIREAGaTHRWIADREFETVELEVDgesyEVTVKIAsdAG 413 Natronococcus...
WP_049953072   350 VSILPATMKKSRPGHLVKVICKPENRERVTRALAEETGTLGIRETGaTHRWIANREFETVALERDgdryEVGVKIAsdAD 429 Halostagnicol...
WP_013878603   337 VSILPATMKKSRPGHLVKVICKPEDRQRVARALAEETGTLGVRDAGaTHRWIARREFETVELELEgetyEVTVKIAsdAD 416 Halopiger xan...
ELY33822       359 VSILPATMKKSRPGHLVKVICKPEDRTRVARRLAEETGTLGVRDAGvTHRWIADREFETVAVDLGgeryEVTVKIArdSD 438
ELY40551       302 VTLLPTTMKKSRPGHLVKVICRPENAREVARRLAEETGTLGVRATPgTHRWTARREIESVTVAIDddehEIDVKIAsdDA 381
CDD81428       527 SDTVRNYPEYESVKALAEENEASFHE 552
CCQ32902       391 GVWLDASAEYEDALAVARETDRPVRE 416
Q18FI2         474 GVIYDYSAEYDDALAVATTTDHPVRE 499 Haloquadratum walsbyi DSM 16790
WP_012943347   416 GEVYDVSAEYDDALAVARETGLAVRE 441 Haloterrigena turkmenica
jgi:Natpe_1166 408 GEVYDVSAEYDDAKAVAQATTLPVRA 433
WP_015322679   414 GDVYDVSAEYDDAARTARESGLPVRE 439 Natronococcus occultus
WP_049953072   430 GAVYDVSAEYDDAAAVALETRWSVRE 455 Halostagnicola larsenii
WP_013878603   417 GEVYDVSAEYEDAKAVARETELSIRE 442 Halopiger xanaduensis
ELY33822       439 GAVYDVSAEYDNAVAVASEASTSIRT 464
ELY40551       382 GVVYDASPEYDDAAAIARETGATIRE 407
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap