4XTK,2YZS,4N06,7CR6


Conserved Protein Domain Family
Cas_Cas1

?
pfam01867: Cas_Cas1 
Click on image for an interactive view with Cn3D
CRISPR associated protein Cas1
Clustered regularly interspaced short palindromic repeats (CRISPRs) are a family of DNA direct repeats found in many prokaryotic genomes. This family of proteins corresponds to Cas1, a CRISPR-associated protein. Cas1 may be involved in linking DNA segments to CRISPR.
Statistics
?
PSSM-Id: 460366
Aligned: 339 rows
Threshold Bit Score: 163.009
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4XTK_A           12 YLFSSGT-LKRKANTICLET-------EsG----RKYIPVENV--MDIKVFGE-VDLNKRFLEFLSQKRIPIHFFNREGY 76  Thermotoga m...
jgi:Mpal_2165    13 VVSGYGAhIKSTPRLLIVQK-------NgT----TTEYPIGDV--HHLLVVGG-HTIHSAVLQHMQNAGNWVSFFAADGT 78 
WP_013328359     10 VVWGFGGhIKSTATTLIILN-------KsD----VEEIPIKSV--DHLLVVGG-HNIHTSAIIHLLRQNSSVSFFDADGT 75  Methanolacin...
Q4J7P5            4 lVIKNATiMRKGSDLQMTWS-------VgK----NLTVSSLDL--ELVVIVGNnVRLTSEVILFLSSLNIPVLVHGKRN- 69  Sulfolobus a...
jgi:Igni_1073     4 vVRGH-AfVGRKGYMITVRY-------KkDgkevTEAFPALDI--EMAVFVGKgITVSTAALQLLEEQNVPTLFHGVD-W 72 
Q0W7W0            5 LIQGFGTrISVEKRRLKIST-------EtN----DYEFYPHQIdhDTIVIDGFtGNISFEAMRWIMKHKINLTLLDWNGN 73  uncultured m...
WP_008082266      5 LVSGYGIsINVDKRKLVIRE-------KgKq---VHEFYPHQInyDSLIIEGYyGNISFEAIRWLMKHNITVSVLNWNGN 74  Aciduliprofu...
jgi:Metfor_2017   5 llnghgIdMHVDGAKLFIRDgrfttkeEpKq--yCFTPQRIDI--SSIVIYGRsGNISIEAIRWLIKHGIQITIMNWDGK 80 
Q12YE1           12 nmrvdSAkLHIKDGRFSTTE-------DpEe--yVFSPKRMDI--DSIVVYGRsGSLSLEAIRWLIKHNVQITILDWNGK 80  Methanococco...
WP_013037755     12 dmriSGAkLHIKEGRFSTTE-------EpQe--yVFSPKRMDI--DNIVVYGKsGNLTLEAIRWLIKHNVQISILNWDGK 80  Methanohalop...
4XTK_A           77 YVGTFYPreYLNSGFLILKQAEHYINQEKRMLIAREIVSRSFQNMVDFLKKRKVRA----------DSLTRYK----KKA 142 Thermotoga m...
jgi:Mpal_2165    79 PVGLIRPp-EDRVDEQVRAIQRHAPA----HSYALGITRAALGRRLQVIGETTVVTgesp---lyqGELEVLQda-rQEL 149
WP_013328359     76 PVGVLRPfgRKPDEEMAELQSEVSSYNS-AAEIVRSSIKARIMMIEKAGGEIDRELyykgedeilfTSLEE--------I 146 Methanolacin...
Q4J7P5           70 DVVLVSPf-LNSLVNVRRKFYTLSDDMK--LYLARKFIKGKILGMINVAKYFMYLT----------KVPVEIDle-lKQI 135 Sulfolobus a...
jgi:Igni_1073    73 SFVTINPv-KVGWSRARKNQYSMGETEL-GVKVAKEFIFGKLEGMSNVAKNLSYKGkk------ptPNSDYWRsegrGEL 144
Q0W7W0           74 LLGTWMPk-ETSVGKLRVKQYAKYLDPTTRYNIAYQIIKEKVKKSCNLLTELSDYYeeldkseieeAFINEYTgf--vAY 150 uncultured m...
WP_008082266     75 LLSVFLPk-EPINGKLKIRQYEIYINEKERLKIAEKILEEKIRKSENMLYELSEYYpeieh-ikvkKRIEKEEk-----L 147 Aciduliprofu...
jgi:Metfor_2017  81 LLTTMLPp-ESVQVKTKFAQYRAFEDKKLRLQIARQFIDAKFERTHLVLDYLHQRYpdve--tdfsSESAK--------L 149
Q12YE1           81 LLTTMLPs-ESTNVKTKFAQYHAYEDQDTRVKLAKKFIEAKFSKSEAVLDYLKLRYp---------EINYDISvd-kGKL 149 Methanococco...
WP_013037755     81 LLTTMLPp-ESTNVKTKFAQYHAFEDEQTRVKLAKKFIEAKFDKSIVVLDFLKQRYpdie--fdfsDd--------vEKL 149 Methanohalop...
4XTK_A          143 EEA--------SNVSELMGIEGNAREEYYSMIDSLVS---DeRFRIE----KR---TRRP------P-----KNFANTLI 193 Thermotoga m...
jgi:Mpal_2165   150 EYL--------VTLDEIRRLHRLATDMYYEIMARTIP---K-GTGFR----RR---TARP------Y-----MDPVNTML 199
WP_013328359    147 DYL--------IKMEELRRIQKFTSDMYYEIMGRCLT---P-SHGFK----RR---TSRP------H-----VDPVNSLL 196 Methanolacin...
Q4J7P5          136 DNT--------KSIDELRSVEAEMSKACWEQLRKFLP------PSFT----GR---KPRN------------EDEINRAV 182 Sulfolobus a...
jgi:Igni_1073   145 ASC--------KNLDCVKKLEAEWSSKLWKDIVQFVP-------GMR----SR---VPRG------------NDPPNRTL 190
Q0W7W0          151 NKKe------qHDINKIMVYEAKTAKAYWDRLTKVFNklyP-DFRFT----GR---RNKSnswnmnA-----SDEINALL 211 uncultured m...
WP_008082266    148 KRDmelkeenkPKLSYLLMYEGRVAQIYWKELSKIFNklyP-EFNFT----SR---STKSyswnmnA-----SDEINALL 214 Aciduliprofu...
jgi:Metfor_2017 150 TKV--------TTIKELMGVEGVVAVHYWDQIQKVIP---D-RLEFTsrcvGR---TNRP------Hg---aADTVNCML 205
Q12YE1          150 ENA--------KSVREILGVEGGVAWKYWNEYAKAIP---E-EYDFR----AR---TDNN------ArasnsGDKVNVML 204 Methanococco...
WP_013037755    150 NKT--------GTIRGLMGVEGGVAWKYWNEFAKAIP---A-EYDFC----ARldqYRRP------Ia---aGDKVNVML 204 Methanohalop...
4XTK_A          194 SFGNSLLYTTVLSLIYQTHLDPRIGYLHETNFRRFSLNLDIAELFKPAVVDRLFLNLVNTRQIN-EKHFDEISE-GLMLN 271 Thermotoga m...
jgi:Mpal_2165   200 SFSYGILSGVCAVHLAGAHLDANIGLLH---QGERALVRDLTELFKPQMVDQPIFALVRQG-IT-ASDYEIGES-RCTLS 273
WP_013328359    197 SLGYSILFGNCCVPLVGAYLDVDKGIL---REGTNSLILDLIDPLKPFMVDSVVFSIA-REYLT-DDMYETNTK-RCHLD 270 Methanolacin...
Q4J7P5          183 DYAYSVIYALCTHSLIASGLDPYGGLMHVEYPGRTALTYDFSEMFKPVAIHSV-IAVSRKVKLK-------LDN-SGYLS 253 Sulfolobus a...
jgi:Igni_1073   191 DYLYALLYSVCNHALVGAGLDPYAGLIHRERAGKLSFVYDFSEMFKP-MAIYVMATAIRTYKIElEGD---------FLN 260
Q0W7W0          212 NYGYAILEAQIRRPINAMGLDPAMGYLHEMKGSGAPLVYDLQELYR-WLIDLSVIQLLEEKKLK-KNDFIVTENyHLRLR 289 uncultured m...
WP_008082266    215 NYSYALLESMIRKHINAVGLDPSIGFLHELASSKTPLVYDLQELFR-WVSDLSVIQLLEDKKLK-KSSFIVTENyHIRLK 292 Aciduliprofu...
jgi:Metfor_2017 206 NYGYSLLEAECLRAINSVGLDAHVGYLHEMAIGKNSLAYDFQELFRF-IVDLAVINLIEADRME-KKDFIRTDNyTLRLR 283
Q12YE1          205 NYGYALLESECLRAINSVGLDAHVGFLHEMNPSKNSLAYDLQEPFRF-IVDLTVMNLIEKGIMD-SKDFIRTESfSLRLR 282 Methanococco...
WP_013037755    205 NYGYALLEAECLRAINSVGLDPHVGFLHEMNSSKNSLAYDLQEPFRF-IVDLAVFSLVEKGAMD-KQDFIRTETyALRLK 282 Methanohalop...
4XTK_A          272 DEGKSLFVKNYEQ 284 Thermotoga maritima MSB8
jgi:Mpal_2165   274 DALIRRMLLHLqt 286
WP_013328359    271 QGTLRLLSNALKs 283 Methanolacinia petrolearia
Q4J7P5          254 KESLGHLTKHLYE 266 Sulfolobus acidocaldarius
jgi:Igni_1073   261 KESLQKVTQLFys 273
Q0W7W0          290 EATAKKLIERIKl 302 uncultured methanogenic archaeon
WP_008082266    293 PQTSKLLVEKFKl 305 Aciduliprofundum boonei
jgi:Metfor_2017 284 STGARKITDEINg 296
Q12YE1          283 PTGARKVTEEFNs 295 Methanococcoides burtonii DSM 6242
WP_013037755    283 PTGARKVTEEVNQ 295 Methanohalophilus mahii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap