Conserved Protein Domain Family
HOK_GEF

?
pfam01848: HOK_GEF 
Hok/gef family
Statistics
?
PSSM-Id: 426473
Aligned: 8 rows
Threshold Bit Score: 50.4529
Created: 19-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7N340          25 AIFIAIVICIAALAAVLVTRKDLCEVRIRSGQTEVAVFMDY 65  Photorhabdus laumondii subsp. laumondii
Q32KA3          26 MIVALIVICITAVVAAQVTRKDLCEVHIRTGQTEIAVFTAY 66  Shigella dysenteriae Sd197
P0ACG6           7 MLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAY 47  Escherichia coli K-12
wugsc:KPN_03095 23 ALVAIIVLCITVLGFTLLVHSSLCELSIKERNIEFKAVLAY 63  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
wugsc:KPN_03921 26 LLFGLVVICFTILLLTWMVRDSLCELQRRQGNIELVAFLAC 66  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Q328L8           6 RLLSLIVICFTLLFFTWMIRDSLCELHIEQGGYELAAFLAC 46  Shigella dysenteriae Sd197
P77494           6 LVVCLLIICITILTFTLLTRQTLYELRFRDGDKEVAALMAC 46  Escherichia coli K-12
WP_014715816     8 AVWCLLIVCLTLLLLTLIIRPQLCEVRIIQGDREIAAIMAC 48  Shimwellia blattae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap