1N05,3BNW,1T6Z


Conserved Protein Domain Family
Flavokinase

?
pfam01687: Flavokinase 
Click on image for an interactive view with Cn3D
Riboflavin kinase
This family represents the C-terminal region of the bifunctional riboflavin biosynthesis protein known as RibC in Bacillus subtilis. The RibC protein from Bacillus subtilis has both flavokinase and flavin adenine dinucleotide synthetase (FAD-synthetase) activities. RibC plays an essential role in the flavin metabolism. This domain is thought to have kinase activity.
Statistics
?
PSSM-Id: 460295
Aligned: 1005 rows
Threshold Bit Score: 65.862
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1N05_A            20 SPYPIRFEGKVVHGFGRGsKELGIPTANIS---EdaiqellryrD-SGVYFGYAMVQK---------------------- 73  fission yeast
CBN75781         269 SGRVRYLRGTVSTGYGRGsKKLGVPTANLPesqfae---nlrtlP-TGVYFGWAALEGaankegeggkgdasggggdgge 344
EEC48785           1 L----RLRGKVDSGYGRGgKKLGFPTANLPsrlfqn---alqdvP-AGVYFGWALLESdelaa-------------pgrn 59 
XP_002290581     123 INPILRLRGPVATGYGRGgKQLGVPTANLPaslfqs---aledvA-TGVYFGWAVVEApstds------------tigrn 186
XP_006968282     297 APFPVKFDGKVVQGTGRStAELGIPTANLSgvsDqv------klRmGGVFAAWACIQMprnsngesia---vmddmlptd 367
EHK41625         275 APFPVKFDGKVVPGTGRSySELSIPSANLSgvsDqi------klRmPGVFAAWACIHIppsnnneka-----pgdvlptd 343
A0DNQ5           195 KLNPIEFTSKIIHGRNRGgTMLGIPTANLQi--NeeiqqltknlL-PGVYAGITYLEN---------------------- 249 Paramecium ...
EFN59949           1 ---PIRLSGRVIHGFGRGsKKLGVPTANLPpaplaq---qlaelP-AGVYFGWPEADR---------------------- 51 
jgi:MICPUN_61683 283 MRDAVEMRAKVVSGFGRGsKQMGTPTANMDptvlap---qlermR-RGVYFGFARLPDdpd-----------------nd 341
XP_001008721     270 LPQKVVCESKVIHGHGKAaKELGIPTANLEv--TkeieqkinhlL-TGVYAGTALLNG---------------------- 324 Tetrahymena...
1N05_A            74 RVFPMVMSVG---WNPY--YKNKL---RSA-EV---HLI-----Er------------------qGED-----FYEEIMR 113 fission yeast
CBN75781         345 GLWKCVANVG---YSPT--FAGQEnaeKIV-EG---HLIgye-----------------------geD-----FYGRTMR 387
EEC48785          60 IAHKAVVNVG---FSPT--FEGQEnaeKIV-EA---HLM-----Aee-----------------pLTD-----FYNETMR 103
XP_002290581     187 TPIKAVVNVG---YSPT--FEGKEnkeKIV-EA---HLItsnspMekneladeystssaddtkieG-D-----FYGETMR 251
XP_006968282     368 WLEA-VVTIApsrHAPP---SVAMk--NSV-SVhiiH------------------------------DfeethFIDAKLK 410
EHK41625         344 WFEA-IVTIApsrHAPP---SVAMe--NTI-TVhiiH------------------------------DfhganFVSAKVK 386
A0DNQ5           250 KQYGGVLSIG---YNPY--FLDTP---QTI-EV---HLY-----Ge------------------fQED-----FYGANLR 289 Paramecium ...
EFN59949          52 RVHKMVMNIG---RRPT--FGDAEp--ELSvEA---HVM-----Ha------------------ySQD-----FYDQPLR 93 
jgi:MICPUN_61683 342 SWSKCVINVG---QRPTfaDGDG----VTI-EV---HVMrlm-----------------------grD-----FYGETME 382
XP_001008721     325 SQYQALFFLG---SSQY--FEDSK---KQL-EC---YVY-----Hd------------------fEKD-----FYESNIK 364 Tetrahymena...
1N05_A           114 VIVLGYIRPELNYA-GLDKLIEDIHTDIRVALNSM 147 fission yeast
CBN75781         388 MLLAGFQRREKKFA-SFPELVATINKDVGDAAMAL 421
EEC48785         104 LQLHGFLRPEIKFS-SFPDLIKQINADVVDAKEAL 137
XP_002290581     252 LQLIGFLRAERKFD-SFPDLIAQIHRDIGNAAWAL 285
XP_006968282     411 VLLMGFLHPASPPHtPPDHLAAEHSQDVMNTLASL 445
EHK41625         387 VLLMGHLHPAAGHNtPPEVLVNQHFQDVDKTMASL 421
A0DNQ5           290 LIITHFLRPESDFR-TFDHLIKAISNDKIIARKLV 323 Paramecium tetraurelia
EFN59949          94 LVVLGYIRPEVKFG-GLQELLARINTDIGIARSQL 127
jgi:MICPUN_61683 383 CVALGYLRPEMRFK-GLRELVGRIMTDIGLARNAL 416
XP_001008721     365 VEITHFTRPEADFK-EFDHLIKVIHCDHAQGKLIQ 398 Tetrahymena thermophila SB210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap