2UUV,2VFU,5JZX,1UXY,3I99


Conserved Protein Domain Family
FAD_binding_4

?
pfam01565: FAD_binding_4 
Click on image for an interactive view with Cn3D
FAD binding domain
This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
Statistics
?
PSSM-Id: 426326
Aligned: 121 rows
Threshold Bit Score: 69.9224
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2UUV_A 138 PDLIVLPHSHEEVERLVQLAHKYNVVIIPMGGGSNIV-GAIEpvsneRFTVSIDM-RR-MNK--VLWVDR----R--EMT 206 Dictyostelium discoideum
P59450  20 AKKIIIVKTIKTLIKTWKKCNQENLPFLLLGKGSNVLfTKN------YNGFVVVN--R-ISGitIHEQKD-------YWL 83  Buchnera aphidicola s...
Q8ZAN4  20 ASNVISAGSVETLIAAWHESKAKRQPVLLLGEGSNVLfIKN------FSGTVL------LNR--IMGITStedsA--AWY 83  Yersinia pestis
Q6DAP0  20 ASCIKVADTQDKLIEEWRVASASQEPVLLLGEGSNVLfLEDF-----LGTILLNR----LKGidIREESD-------GWY 83  Pectobacterium atrose...
1UXY_A  15 AQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLfLEDY-----RGTVIINR----IKGieIHDEPD-------AWY 78  Escherichia coli
3I99_A  31 AAQLVVAESIDDLKALYCSAEWASLPKLIIGKGSNXLfTCH------YTGXIVVN--R-LNGieHQQDDD-------YHR 94  Vibrio cholerae O1 bi...
Q7VPJ2  19 ANQIIEFTTVSQLITEWQKATRADQAVLILGQGSNVLfLDD------FNGVVLVN--K-LKGiqHREDHD-------YHY 82  [Haemophilus] ducreyi...
Q87YF8  23 ARLFAQARNDDEVREALAYSAEHDVPLLVIGGGSNLLlSGD------VQALVLRMaSRgIRI--VREDCL-------EAI 87  Pseudomonas syringae ...
Q9X6Y8  33 aPAFVALTEPSQLPALSALAPRFR-QLVVLGGGSNVVlPAS------IDGLVAQV--R-LPGvrLVGQCA----D--AWV 96  Bordetella pertussis ...
Q5F9J9  22 aRAFIALKHADELRDIVRLPEFDRDTVLWLGGGSNILlMQD------YDGLVVHM--E-NKG--IREIAR----SdgMVL 86  Neisseria gonorrhoeae...
2UUV_A 207 ACIQVGIMGPELEKQLhKQGVSLGHDPDSFEFSTLGGWLATCSSGHQSDKYgdieDMAVSFRTVT-PTGTL-ELR 279 Dictyostelium discoideum
P59450  84 LHVKGGTKWNNLVKYT-IQKKIYGLENLALIPGTVGAAPIQNIGAYGVEFK----DVCQYVDVLYlNNSKIvRIN 153 Buchnera aphidicola str. B...
Q8ZAN4  84 LHVGAGENWHQLVCHS-LQNNMPGLENLALIPGCVGSAPIQNIGAYGVELK----QVCEYVDLLDmDKGTIqRIS 153 Yersinia pestis
Q6DAP0  84 LHVGAGENWHQLVEYT-LKCGITGLENLALIPGCVGSAPIQNIGAYGIELQ----HVCDYVELLDlTEGKTiHLT 153 Pectobacterium atrosepticu...
1UXY_A  79 LHVGAGENWHRLVKYT-LQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQ----RVCAYVDSVElATGKQvRLT 148 Escherichia coli
3I99_A  95 LHVAGGEDWPSLVSWC-VEQGIGGLENLALIPGCAGSAPIQNIGAYGVEFK----DVCDYVEYLClETGTVkRLT 164 Vibrio cholerae O1 biovar ...
Q7VPJ2  83 IQAQGGENWHNLVEWT-LAKNIAGLENLALIPGVVGSAPIQNIGAYGVEFE----QFCDFVEVVNlANGQIfRLD 152 [Haemophilus] ducreyi 35000HP
Q87YF8  88 VEAEAGEPWHPFVQSC-LELGLAGLENLSLIPGTVGAAPMQNIGAYGVEIK----DVFHGLTALDrETGELrEFA 157 Pseudomonas syringae pv. t...
Q9X6Y8  97 VEAAAGENWHGFVTAC-VDNGWDGLENLALIPGTVGAAPVQNIGAYGVELA----DRFHSLTAWDvKGGRWvEMg 166 Bordetella pertussis Tohama I
Q5F9J9  87 IEAQAGEIWHDFVLHT-VALGLSGLENLSLIPGTVGASPVQNIGAYGVEAK----DVIHSVRCFDlDTETFvTLs 156 Neisseria gonorrhoeae FA 1090
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap