Conserved Protein Domain Family
HCV_capsid

?
pfam01543: HCV_capsid 
Hepatitis C virus capsid protein
Statistics
?
PSSM-Id: 144947
View PSSM: pfam01543
Aligned: 5 rows
Threshold Bit Score: 139.061
Threshold Setting Gi: 75569155
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q70GD2      2 STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPTPRHVGPRAGPGLSPGT 81  Hepatitis C virus ...
Q6XJ40      2 STLPKPKRQTKRNTLRRPKNVKFPAGGQIVGEVYVLPRRGPQLGVREVCRAYEWSQPRGRRQPTPKARPREGRSWAQPGY 81  Hepacivirus C
NP_751919   2 STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGY 81  Hepatitis C virus ...
BAF91757    2 STLPKPQRQTKRNTTRRPQNVKFPGGGQIVGGVYVLPRRGPRLGVRAVRKTSERSQPRERHQPIPKARPREGRSWLSLGT 81  Hepacivirus C
Q86686      2 ATNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPKLGVRATRKTSERSQPRGRRQPIPKARRPRAGPGLSPGT 81  Hepatitis C virus ...
Q70GD2     82 LGPsmamraAVGRDGsClpvalGLAGAPQTPGVGRAIWVRSSIPLR 127 Hepatitis C virus genotype 1
Q6XJ40     82 PWP------LYGNEG-C-----GWAGWLLPPRGSRPSWGQNDPRRR 115 Hepacivirus C
NP_751919  82 PWP------LYGNEG-C-----GWAGWLLSPRGSRPSWGPTDPRRR 115 Hepatitis C virus genotype 1
BAF91757   82 LGPstgmraVVGQDGfC------------------------PPVVL 103 Hepacivirus C
Q86686     82 LGPstatraWGGQDGsC----------------------------H 99  Hepatitis C virus (isolate Hunan)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap