Conserved Protein Domain Family
Lipoprotein_7

?
pfam01540: Lipoprotein_7 
Adhesin lipoprotein
This family consists of the p50 and variable adherence-associated antigen (Vaa) adhesins from Mycoplasma hominis. M. hominis is a mycoplasma associated with human urogenital diseases, pneumonia, and septic arthritis. An adhesin is a cell surface molecule that mediates adhesion to other cells or to the surrounding surface or substrate. The Vaa antigen is a 50-kDa surface lipoprotein that has four tandem repetitive DNA sequences encoding a periodic peptide structure, and is highly immunogenic in the human host. p50 is also a 50-kDa lipoprotein, having three repeats A,B and C, that may be a tetramer of 191-kDa in its native environment.
Statistics
?
PSSM-Id: 110537
View PSSM: pfam01540
Aligned: 3 rows
Threshold Bit Score: 456.854
Threshold Setting Gi: 75426518
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O53104   1 MKKSKKIFITLCGIATTAILPVATISCNDDKLAEKNGKEKADAALKQANALAEELKKNPDYSKILETLNKEIAEATKSFK 80  Mycoplasma hominis
O53100   1 MKKSKKIFITLCGIAATAILPVATISCNDDKLAEKNGKEKADAALKQANTLAEELKKNPDYAKILETLNKEIAEATKSFK 80  Mycoplasma hominis
O53101   1 MKKSKNIFITLCGIAATAILPVATISCNDDKLAEKNGKEKADAALKQANALVEELKKNPDYSKILETLNKEIAEATKSFK 80  Mycoplasma hominis
O53104  81 EAGSYGDYPAIISKLSAAVENAKSEQQKVDQANKKIAdenlkikegakellklsekiqsfadtialtitklegkkfeide 160 Mycoplasma hominis
O53100  81 EAGSYSDYPAIISKLSAAVENAKNEKKAIDDKNAQIA------------------------------------------- 117 Mycoplasma hominis
O53101  81 EAGSYGDYPAIISKLSAAVENAKNEKKAIDDKNAQIA------------------------------------------- 117 Mycoplasma hominis
O53104 161 tfkkqlistiellnkksvevktfatvntikkdfllselesfkefntswlekivseweevkkawskelaeikadddKKLAE 240 Mycoplasma hominis
O53100 118 ---------------------------------------------------------------------------KELAE 122 Mycoplasma hominis
O53101 118 ---------------------------------------------------------------------------KELAE 122 Mycoplasma hominis
O53104 241 ENQKIQNGIAELTKLSKENSDLAETIEETIAKLEKKFQIPKDFKEKLTSTIKLLNKKANEINTFVSTVSKKTEFVLEFLE 320 Mycoplasma hominis
O53100 123 RNAKIQSNIEELKKINNEAFELSKTVNKTIAEVEKKFKIDDKFKEQLENFADDLLDKSRQIDEFTTVTSTQEGFTLAELE 202 Mycoplasma hominis
O53101 123 RNAKIQSNIEELKKINNEAFELSKTVNKTIAEVEKKFKIEASFKEQLENFADDLLDKSRQIDEFTTVTSTQEGFTLAELE 202 Mycoplasma hominis
O53104 321 SFKELNTLQFNEIKTEWAKVQEAWKNELTEIN---SIIKGVEELKKLSHEISEFSNSVKKTISELEKKFKIDDTtnkeea 397 Mycoplasma hominis
O53100 203 SFKEITTTWFNGMKSEWARVLDAWKKEIEEINedkQIKSGIEELNKLNAEVENLKNEIEQTIEKVDKKFKIDDK------ 276 Mycoplasma hominis
O53101 203 SFKEITTTWFNGMKSEWARVLDAWKNELTEIN---SIIKGVEELKKLSHEISEFSNSVKKTISELEKKFKIDDKtnkdea 279 Mycoplasma hominis
O53104 398 kkFKNELENFADQLLNKSHEIDKFVTVTSARGDFSLSELESFKSFNTTWFNEMKSEWARVQEAWKDQLKEISTK 471 Mycoplasma hominis
O53100 277 --FKKQLDLLVEDLLEKGRQIDEFTTVTAIQKDFNLLELETFKQFNTSWFKEVKAEWAKVLDAWKDQLKEISAK 348 Mycoplasma hominis
O53101 280 kqFKNELENFADQLLNKSHEIDKFVTVTSAREDFSLSELESFKSFNTTWFNEMKCEWARVQEAWKDQLKEISTK 353 Mycoplasma hominis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap