Conserved Protein Domain Family
Rota_NS26

?
pfam01525: Rota_NS26 
Rotavirus NS26
Gene 11 product is a non-structural phosphoprotein designated as NS26.
Statistics
?
PSSM-Id: 144935
View PSSM: pfam01525
Aligned: 6 rows
Threshold Bit Score: 152.055
Threshold Setting Gi: 269857606
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q32Y78     1 MSDFGIN---LDAICDNVKKGQTESRTGSQLSNRSSRRMDFV--DDEELSTYFNSKA--SVTQSDSCSNDLAMKHSIITE 73  Human rotavirus C
P36358     1 MSDFGIN---LDAICDNVKYKSSNSRTGSQVSNRSSRRMDFV--DEEELSTYFNSKA--SVTQSDSCSNDLAVKTSIITE 73  Porcine rotavirus C...
P34718     1 MSDFGIN---LDAICDNVRRNSSNSSIKSQVSNRSSRKMDFV--DEDELSTYFNSKT--SVTQSDSCSNDLNVKHSIIAE 73  Bovine rotavirus Sh...
ACZ51852   1 MS-LSIDvtsLPSISSSIFKNESSSTTSTLSGKSIGRNEQYVssDIEAFNKYMLSKSpeDIGPSDSASNDPLTSFSIRSN 79  Rotavirus A human/B...
O55589     1 MSAITIDfssLPSF-SKLSTNESSSETSNTSRKSVSRSEQYVslSEKAFSEYMLNRDpeDIGPSDSASNDLPTKFAIKSN 79  Avian rotavirus PO-13
Q32UE7     1 MSDFGIN---LDAICDNVKKSQTESRTGSQLSNRSSRRMDFV--DDEELSTYFNSKA--SVTQSDSCSNDLAMKHSIITE 73  Human rotavirus C
Q32Y78    74 AVVCDESAHVSADAIQEKDET----VPQIDHRIMKWMLDSPDGVSLNGGINFTRAKSKVKe------------------- 130 Human rotavirus C
P36358    74 AVICDESEHVSADAIQEKEES----IMQVDDNVMKWMMDSHDGISMNGGINFSRSKSKTG-------------------- 129 Porcine rotavirus C...
P34718    74 AVVCDESAHVSADAVQEKDVV----VPKMDESVMKWMMDSHDGICVNGGLNFSKLKNKSNe------------------- 130 Bovine rotavirus Sh...
ACZ51852  80 AVKTNADAGVSMDSSTQSRPSsnvgCDQMDFSLTK-------GINVSASLDSCVSISTNHk------------------- 133 Rotavirus A human/B...
O55589    80 AVKSNANVGVSLDASSADRETgsntKDEVDFSFAK-------GIKMKSDVAASFTIDTSNikssisdpgssaksanytdv 152 Avian rotavirus PO-13
Q32UE7    74 AVVCDESAHVSADAIQEKDET----VPQIDHRIMKWMLDSHDGVSLNGGINFTKAKSKVKe------------------- 130 Human rotavirus C
Q32Y78   131 -tENEITEMKSKTNLLVNASVDINSNIGTFNPINQKVKTEAVSDIFEDEDIEGCICKNCPYREKYRKLRSRMKNVLIDMI 209 Human rotavirus C
P36358   130 --RSDFTESKSETSVSAHVSAGISSQLGMFNPIQNTVKKEAISEMFEDEDGDGCTCRNCPYREKYLKLRNKMKSVLVDMI 207 Porcine rotavirus C...
P34718   131 -hETKVT---SETNVSAHVSAGINSQLGMFNPIQHKIKKEAIPEMFEDEDTDECTCRNCPYKEKYLKLRKKLKNVLVDII 206 Bovine rotavirus Sh...
ACZ51852 134 -kEKSKKD-KSRKH---YPRIEADSDSEDY--------------VLDDSDSDDGKCKNCKYKKKYFALRMRMKQVAMQLI 194 Rotavirus A human/B...
O55589   153 ikSRSKSRNKSCKNDQKWPRIEYQSDEEEF--------------VLSDEDAQ---CCNCIYKRKYFELRKRMKLVAIQLI 215 Avian rotavirus PO-13
Q32UE7   131 -tENEITEMKSKTNLLVNASVGINSNIGAFNPINHKVKMEAVSDMFEDEDIEGCICKNCPYREKYRKLRSRMKNVLIDMI 209 Human rotavirus C
Q32Y78   210 NEM 212 Human rotavirus C
P36358   208 NEM 210 Porcine rotavirus C strain Cowden
P34718   207 TEM 209 Bovine rotavirus Shintoku strain
ACZ51852 195 EDL 197 Rotavirus A human/Bethesda/DC130/1976/G3P[8]
O55589   216 EDM 218 Avian rotavirus PO-13
Q32UE7   210 NEM 212 Human rotavirus C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap