3MDB,2OLM,2OWA


Conserved Protein Domain Family
ArfGap

?
pfam01412: ArfGap 
Click on image for an interactive view with Cn3D
Putative GTPase activating protein for Arf
Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Statistics
?
PSSM-Id: 426250
Aligned: 117 rows
Threshold Bit Score: 112.714
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3MDB_D           25 RAVLELLQR-PGNARCADC---GAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAAR 100  human
XP_001705811     10 KNAIDALRRkPENKQCADC---KSLSVPYINLTCGTFVCARCAGIHREF--DHRVKSVSNSVFKLDEIQAL--GGNDLDK 82   Giardia int...
Q8RXE7           12 EKIIRGLMKlPPNRRCINC---NSLGPQYVCTTFWTFVCMACSGIHREF--THRVKSVSMSKFTSKEVEVLQNGGNQRAR 86   thale cress
Q86H99            5 DTILWRLRElEENSKCADC---TDSFPRYMNTTYGTFVCSVCGAIHRELg--NRVKSISSDKFTQQDIERLEKVGNKMAD 79   Dictyosteli...
EAX92305         37 QKILRNLMKlPSNKKCADC---GEQCAVQVDTTNAIFLCSICSGIHREFg--FRIKSVSMATFTPEEIQKLQATNNDEFN 111  Trichomonas...
CAG00723         14 ARKVRELAQsGVNKHCFEC---GQPGVTYTDITVGSFVCTSCSGMLRGLNPPHRVKSISMTTFSQPEVEFLQNHGNEVGR 90   spotted gre...
2OLM_A           13 LKMLRDMTGlPHNRKCFDC---DQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCK 89   human
jgi:OSTLU_30703   6 EQALTALARePGNKTCFSCvgpGSLAPRSVCVPFGIFVCTRCSGIFRDF--NFRIKSISASTFSGDEVEMLRRKGNEAAR 83   Ostreococcu...
Q4DJC3           62 RDEVRKLSQkCGNRFCIDC---GIRGPLYVVTNFRVFVCSTCAALHRSL--QHKVKGISMTEFTDEEVACLNVGGNDRAA 136  Trypanosoma...
Q55GS5            6 ERQIRELLKlPENLKCMDC----PQGSVYACLDLATFVCQSCSGIHSNFg--RRVKSVSMGTFKPEEVSKLKAGGNKAAR 79   Dictyosteli...
3MDB_D          101 ARFESKVPSFYYRp--TPSDCQLLREQWIRAKYERQEFIYPE 140  human
XP_001705811     83 RTYLPYWSEQVFKlpePGSEDNGRVRDFIRMKYVEKRFCHEQ 124  Giardia intestinalis
Q8RXE7           87 EIYLKNWDHQRQRl--PENSNAERVREFIKNVYVQKKYAGAN 126  thale cress
Q86H99           80 EIWLSKWSQQQYPl--PFPSDEKRVRDFIKMKYIEKKWIKEG 119  Dictyostelium discoideum
EAX92305        112 RVWMAKWKASEDPfpiRDDANYNSRNNFLKRKYVDKLWYSKK 153  Trichomonas vaginalis G3
CAG00723         91 RTWLCAFDPKTSGc--PDTKDSQKLKEFLQDKYEKKKWHFSK 130  spotted green pufferfish
2OLM_A           90 QIWLGLFDDRSSAi--PDFRDPQKVKEFLQEKYEKKRWYVPP 129  human
jgi:OSTLU_30703  84 RTFLARWNPAEPL---PQSGNTVRGKVWIKAVFVDKLYYDDA 122  Ostreococcus lucimarinus CCE9901
Q4DJC3          137 RVWLASYENNKPP-----HGSDIAVRDFIVNAFENMAYVNRE 173  Trypanosoma cruzi
Q55GS5           80 AYWLARWRPSDFPe--PSEGDQTRIRQFIDLKYNKRQWVDNG 119  Dictyostelium discoideum AX4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap