1VQ8


Conserved Protein Domain Family
Ribosomal_L19e

?
pfam01280: Ribosomal_L19e 
Click on image for an interactive view with Cn3D
Ribosomal protein L19e
Statistics
?
PSSM-Id: 426176
Aligned: 123 rows
Threshold Bit Score: 129.893
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VQ8_P               3 DLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRK 82  Haloarcul...
AGN25832             2 DLKNQKRMAADILGCGVNRVWIDPNKIEELSDAITRADIRTAIESGTIKALPVRGNSRGRIRHNLAQRKKGRQRGPGSRK 81 
licsiro:TALC_01316   3 DLRNQKRLAADILKCGENRVWIDPEHIEEVQDCITRGDVRTAIDSGLIKAKPKNGTSRGRIRHAAKQKASGKRKGPGSRK 82 
jgi:Aboo_1503        2 DVKFQRRLAASILKCGEERVWMDPNALDEIKEAVTREDIKMLIKRGLIKRKKIKGTSRVRANYIKMQKEKGRRKGPGSRK 81 
EQB64735             3 TLSPQKRMAASIMKSGKSRVWMDTKSIDDIAEAVTRDDVRKLIKRNVIQKKPAKGNSRSRFKVAKAQRNKGRRKGQGSRK 82 
EQB71657             2 KLNTARRLAADEFKSGLSRVWVDTNSIDQVMEAASRQDIRDLIRRNVIQVKQKKGNSNARLKKRVVQRSKERRRGPGSIK 81 
EQB66911             2 RMETAKRIAADEFKSGVSRVWVDTNSVSEVLECATRDDIRQLIRRNVIQLKQKKGNSNWRLKKRIAQISKERRRGPGSIR 81 
EQB68270             2 RVETAKRIAADEYKSGVSRIWVDMDSLTLVQEAATREDVRNLMEKHVIQAKPKKGNSNARFKKRLKQLSKERRRGPGSVR 81 
Q9HIS5               2 rSDSVKRIVADIKGVGTSRVYIDTNKVDRVMEAATRQDVIALMKQDVIKIKQKKGISNGRLKKRIKQLSKDRRRGPGSLR 81  Thermopla...
Q6L1A9               2 KVQSVKQIAADEMKVGVSRVWIDTNSIDQVLDATSREDVRKLIDLHIIQKKQKKGNSNYRLKKRIEQLAKGRRRGEGSVR 81  Picrophil...
1VQ8_P              83 GKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDAN 145 Haloarcula marismortui
AGN25832            82 GRSGARSPRKRRWIQTIRPIRAELKELRDTGKISKQTYRLFYRKAKGGQFKSRNHLLSHMKAS 144
licsiro:TALC_01316  83 GTANARVPEKRQWIARIRPIRDELKQLRADGKITPSIYRLYYRKAKGGSYTSRRNLKQHMIAD 145
jgi:Aboo_1503       82 GKKYARYPRKQRWMKTIRPIRATLKDLRDSGKIDRHAYRRFYRLAKGGTFKSRSHLLMHLKAE 144
EQB64735            83 GTKNARDPRKRKWVRSIRSMRNALKEMRESGKITRKDYRVFYKKIKGGALRSKNALLLHMREE 145
EQB71657            82 GTKYARFPRKDRWIKTIRALRDELRTMKKDNRIDAKTFRKFYVQVKGGNIHSRAQLVQHMKSS 144
EQB66911            82 GTKYARFPRKARWIKTIRPLRDELRTLKTSGRIDPKVYRKYYRVIKGGSVRSRAQLRTQLKAA 144
EQB68270            82 GTRNARFPRKRRWIKTIRALRDELRTLKSENKIDAKTYRKYYRIVKGGTIKSRAQLRSQIRLa 144
Q9HIS5              82 GTKYARYPRKDRWIDTIRALRDELRTLKSEGKITKETYRKYYRFIKSGSIRSRSQLLSHLKSA 144 Thermoplasma acidophilum
Q6L1A9              82 GTKYARFPRKRRWISRIRALRRELRELKTNNKIDKKTYRRYYRIIKSGSFVSRAQLRNHIQAA 144 Picrophilus torridus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap