3CV1,1P7T


Conserved Protein Domain Family
Malate_synthase

?
pfam01274: Malate_synthase 
Click on image for an interactive view with Cn3D
Malate synthase
Statistics
?
PSSM-Id: 426172
Aligned: 12 rows
Threshold Bit Score: 604.385
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3CV1_A        10 LAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDNGT-LP----------DFI-SETASIR-DAD 76  Escherichia coli
O32913        17 YDFVNNEALPGTDINPNSFWSGVAKVVADLTPQNQSLLNSRDELQAQIDKWHrHRviepfdvdayRQFlIDIGYLLpEPD 96  Mycobacterium l...
EDY48984      10 avVTAPAVPRQDEVLTEAALVFLAELHRRFTPRRDELLARRARRRAEISRTG-TL----------DFL-PETAHVRaDDS 77  Streptomyces cl...
Q9RYN3        10 MTINAPIKPEYAEILTPEALAFVAELHRRFEPRRRELMQKREERQQRLDAGE-LP----------DFL-PETAEIR-AGD 76  Deinococcus rad...
P49081        16 VDVRGRYDREFAGILTRDALDFVAGLQREFRGAVRYAMEQRREAQRRYDAGE-LP----------RFD-PATTLVR-EGD 82  Zea mays
XP_009125524  21 vEVRGRYDQVFAKILTRDALGFVAELQREFRGHVRYAMECRREAKRRYNSGA-VP----------GFD-PSTKFIR-DGE 87  field mustard
P30952        18 EPFFKPSSTTVGDILTKDALEFIVLLHRTFNNKRKQLLENRQVVQKKLDSGS-YHl---------DFL-PETANIRnDPT 86  Saccharomyces c...
ESW97754      19 sdkpllskATPRDILTKDALKFIVLLHRSFNETRKQLLENRQKVQERLDAGE-SL----------HFL-EETKYIReDPN 86  Ogataea parapol...
P42450        35 YDFVTEAVLPRVGVDAEKFWSGFAAIARDLTPRNRELLARRDELQMLIDDYHrNNsgtidqeayeDFL-KEIGYLVeEPE 113 Corynebacterium...
1P7T_B        17 KRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRIQAALDEWHrSNpgpvkdkaayKSFlRELGYLVpQPE 96  Escherichia col...
P28344        11 VAILGSVSNEARKILTKEACAFLAILHRTFNPTRKALLQRRVDRQAEIDKGH-LP----------DFL-PETKHIRdDPS 78  Aspergillus nid...
EER32964      15 vQILGPIPDDAKHIFNQETLAFVATLHRGFEARRQELLNNRKEQQKLRDQGF-LP----------DFL-PETEYIRnDPT 82  Candida tropica...
3CV1_A        77 WKI-RG-------------------------------------------------------------------------- 81  Escherichia coli
O32913        97 DFTiSTsgvddeitmtagpqlvvpvlnarfalnaanarwgslydalygtdtipetegaekgseynkirgdkviayarkfm 176 Mycobacterium l...
EDY48984      78 WRV-AP-------------------------------------------------------------------------- 82  Streptomyces cl...
Q9RYN3        77 WKI-SP-------------------------------------------------------------------------- 81  Deinococcus rad...
P49081        83 WTC-AS-------------------------------------------------------------------------- 87  Zea mays
XP_009125524  88 WVC-AS-------------------------------------------------------------------------- 92  field mustard
P30952        87 WQG-PI-------------------------------------------------------------------------- 91  Saccharomyces c...
ESW97754      87 WKC-LP-------------------------------------------------------------------------- 91  Ogataea parapol...
P42450       114 AAEiRTqnvdteisstagpqlvvpilnarfalnaanarwgslydalygtnaipetdgaekgkeynpvrgqkvi-ewgref 192 Corynebacterium...
1P7T_B        97 RVTvETtgidseitsqagpqlvvpamnaryalnaanarwgslydalygsdiipqegamvsgydpqrgeqviaw--vrrfl 174 Escherichia col...
P28344        79 WKG-AP-------------------------------------------------------------------------- 83  Aspergillus nid...
EER32964      83 WTG-PA-------------------------------------------------------------------------- 87  Candida tropica...
3CV1_A        82 -------------------------------------------------------------IPADLEDRRVEITGPVE-R 99  Escherichia coli
O32913       177 dqavplasdswtnatgvsifdgqlqiaigtnstglaspekfvgynrqlrssnwsvllanhgLHIEVLIDPESPIGKTD-P 255 Mycobacterium l...
EDY48984      83 -------------------------------------------------------------APPALQDRRVEITGPAD-R 100 Streptomyces cl...
Q9RYN3        82 -------------------------------------------------------------LPDALKDRRVEITGPVD-R 99  Deinococcus rad...
P49081        88 -------------------------------------------------------------VPPAVADRTVEITGPAEpR 106 Zea mays
XP_009125524  93 -------------------------------------------------------------VPPAVADRRVEITGPVE-R 110 field mustard
P30952        92 -------------------------------------------------------------LAPGLINRSTEITGPPL-R 109 Saccharomyces c...
ESW97754      92 -------------------------------------------------------------THPKLQCRKIEITGPPD-A 109 Ogataea parapol...
P42450       193 ldsvvpldgashadvekynitdgklaahigdsvyrlknresyrgftgnfldpeailletngLHIELQIDPVHPIGKAD-K 271 Corynebacterium...
1P7T_B       175 deslplengsyqdvvafkvvdkqlriqlkngkettlrtpaqfvgyrgdaaaptcillknngLHIELQIDANGRIGKDD-P 253 Escherichia col...
P28344        84 -------------------------------------------------------------PAPGLVDRRVEITGPTD-R 101 Aspergillus nid...
EER32964      88 -------------------------------------------------------------LAPGLIDRRCEITGPTD-R 105 Candida tropica...
3CV1_A       100 KMVINALNANVKVFMADFEDSLAP-----------DWNKVIDGQINLRDAVNGTISYTNE-AGKIYQLK-------PNPA 160 Escherichia coli
O32913       256 VGIKDVILESAITTIMDFEDSVTAvdaddkvrgyrNWLGLNKGDLTEEVNKDGKTFTRVLnADRSYTTPdggeltlPGRS 335 Mycobacterium l...
EDY48984     101 RMTVNALNSGARVWLADFEDSSAP-----------TWENVISGQLALSDAYHRRIDFTDErSGKSYALRp-----dAELA 164 Streptomyces cl...
Q9RYN3       100 KMIINALNSGAKMFMADFEDASSP-----------TWDNCVQGQINLRDAVRGTISLEQ--NGKSYKLN-------DTTA 159 Deinococcus rad...
P49081       107 KMVINALNSGAKVFMADFEDAMSP-----------TWENLMHGQVNLRDAVAGTISFRDApRGRTYELN-------DRTA 168 Zea mays
XP_009125524 111 KMIINALNSGAKVFMADFEDALSP-----------SWENLMRGQVNLKDAVDGSITFNDKaRNKVYKLN-------DQVA 172 field mustard
P30952       110 NMLINALNAPVNTYMTDFEDSASP-----------TWNNMVYGQVNLYDAIRNQIDFDTP--RKSYKLNgn----vANLP 172 Saccharomyces c...
ESW97754     110 KMIVNAFNTDVFTYMTDFEDSCSP-----------TWNNMIYGQVNLYDAIRDRIDFTNEsTGKRYKINre----gRRVP 174 Ogataea parapol...
P42450       272 TGLKDIVLESAITTIMDFEDSVAAvdaedktlgysNWFGLNTGELKEEMSKNGRIFTRELnKDRVYIGRngtelvlHGRS 351 Corynebacterium...
1P7T_B       254 AHINDVIVEAAISTILDCEDSVAAvdaedkillyrNLLGLMQGTLQEKMEKNGRQIVRKLnDDRHYTAAdgseislHGRS 333 Escherichia col...
P28344       102 KMVVNALNSDVWTYMADFEDSSAP-----------TWDNMINGQINLYDAIRRQVDFKQG--QKEYKLRt-----dRTLP 163 Aspergillus nid...
EER32964     106 KMVINALNSNVATYMADFEDSLTP-----------AWKNLVEGQVNLYDAVRRNLTANIN--GKQYALNld---kgRHIP 169 Candida tropica...
3CV1_A       161 VLICRVRGLHLPEKHVT-WRG-----EAIPGSLFDF---ALYFFHNYQAL-------LAKGSGPYFYLPKTQSWQEAAWW 224 Escherichia coli
O32913       336 LLFVRNVGHLTTSDAIL-VDGgdgqeKEVFEGIIDAvftGLAAIHGLKTGeangpltNSRTGSIYIVKPKMHGPAEVAFT 414 Mycobacterium l...
EDY48984     165 TVVMRPRGWHLPERHLTgPDG-----GVLPGALVDF---GLCFFHTARRL-------LDLGKGPYFYLPKLESHQEARLW 229 Streptomyces cl...
Q9RYN3       160 TLLVRPRGWHLPEKHVQ-VDG-----ETLYGAFFDF---GLFFFHNAKEQ-------LARGKGPYFYLPKMESHLEARLW 223 Deinococcus rad...
P49081       169 KLFVRPRGWHLPEAHIL-IDG-----EPAIGCLVDF---GLYFFHNHAAFga----gQGAGFGPLCDLPKMEHSREARIW 235 Zea mays
XP_009125524 173 KLFVRPRGWHLPEAHIL-IDG-----EPATGCLVDF---GLYFFHNYAKFrq----tQGSGFGPFFYLPKMEHSREAKIW 239 field mustard
P30952       173 TIIVRPRGWHMVEKHLY-VDD-----EPISASIFDF---GLYFYHNAKEL-------IKLGKGPYFYLPKMEHHLEAKLW 236 Saccharomyces c...
ESW97754     175 VMIVRPRGWHMVDKHIL-VDG-----EPISASIMDF---GLFFFHNAKFL-------LSQGLAPFFYLPKMEHYKEAQLW 238 Ogataea parapol...
P42450       352 LLFVRNVGHLMQNPSIL-IDG-----EEIFEGIMDAvltTVCAIPGIAPQnk---mrNSRKGSIYIVKPKQHGPEEVAFT 422 Corynebacterium...
1P7T_B       334 LLFIRNVGHLMTIPVIWdSEG-----NEIPEGILDGvmtGAIALYDLKVQk------NSRTGSVYIVKPKMHGPQEVAFA 402 Escherichia col...
P28344       164 TLIARARGWHLDEKHFT-VDG-----EPISGSLFDF---GLYFFHNAKEL-------VARGFGPYFYLPKMESHLEARLW 227 Aspergillus nid...
EER32964     170 TLIVRPRGWHLTEKHVL-VDG-----TPVSGGIFDF---AVYFYNSAKEA-------IAQGFGPYFYLPKMEHHLEAKLW 233 Candida tropica...
3CV1_A       225 SEVFSYAEDRFNLPRGTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNY-PDRVlpdRQAVTMD 303 Escherichia coli
O32913       415 CELFSRVEDVLGLPQGTLKVGIMDEERRTTLNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEA-GPMI---RKGAMKN 490 Mycobacterium l...
EDY48984     230 NDIFLFAQEQLGIPRGTIRATVLIETITAAYEMEEILYELREHASGLNAGRWDYLFSIIKNFRDAgPGFVlpdRNAITMT 309 Streptomyces cl...
Q9RYN3       224 NDVFNYAEDTIQIPRGSIRATVLIETIVAAFEMDEILYELREHSAGLNCGRWDYIFSYIKKLRNH-SDRVlpdRAKVTMA 302 Deinococcus rad...
P49081       236 NGVFQRAEKAAGIEPGSIRATVLVETLPAVFQMNEILHELREHSAGLNCGRWDYIFSYVKTFRAH-PDRLlpdRALVGMA 314 Zea mays
XP_009125524 240 NSVFERAEKMAGIERGSIRATVLIETLPAVFQMNEILYELRDHSVGLNCGRWDYIFSYVKTFQAH-PDRLlpdRVLVGMG 318 field mustard
P30952       237 NDVFCVAQDYIGIPRGTIRATVLIETLPAAFQMEEIIYQLRQHSSGLNCGRWDYIFSTIKRLRND-PNHIlpnRNQVTMT 315 Saccharomyces c...
ESW97754     239 NDIFCVAQDCLEIPRGTIKATVLIETLPISYQLDEVLYALRDHSAGLNCGRWDYMFSTIKRLRNQ-KQHIlpdRHQVTMT 317 Ogataea parapol...
P42450       423 NELFGRVEDLLDLPRHTLKVGVMDEERRTSVNLDASIMEVADRLAFINTGFLDRTGDEIHTSMEA-GAMV---RKADMQT 498 Corynebacterium...
1P7T_B       403 NKLFTRIETMLGMAPNTLKMGIMDEERRTSLNLRSCIAQARNRVAFINTGFLDRTGDEMHSVMEA-GPML---RKNQMKS 478 Escherichia col...
P28344       228 NDVFNLAQDYIGMPRGTIRGTVLIETITAAFEMEEIIYELRDHSSGLNCGRWDYIFSFIKKFRQH-PNFVlpdRSDVTMT 306 Aspergillus nid...
EER32964     234 NDIFNYSQDYIGLKRGTIRASVLIETIPAVFQMDEIIYQLREHSAGLNCGRWDYIFSYIKCLRNH-PDFIlpdRSQVTMA 312 Candida tropica...
3CV1_A       304 KPFLNAYSRLLIKTchkrgaFAMGGMAAFIPSKDE-EHNNQVLNKVKADKSLEANNGHDGTWIAHPGLADTAMAVFNDIL 382 Escherichia coli
O32913       491 STWIKAYEDANVDI------GLAAGFKGKAQIGKGmWAMTELMADMVEQKIGQPKAGATTAWVPSPTAATLHAMHYHQVD 564 Mycobacterium l...
EDY48984     310 APFMRAYTELLVRTchrrgaHAIGGMAAFIPSRRDpEINRAAFEKVRADKDREAADGFDGSWVAHPDLVPVALASFDAVL 389 Streptomyces cl...
Q9RYN3       303 VPMMQNYSKLAIQTchkrgaPAIGGMSAFIPVKGDeEKNAAAFEQVRVDKEREATNGHDGTWVAHPGMVQLATEVFDRIM 382 Deinococcus rad...
P49081       315 QHFMRSYSHLLIHTchrrgvHAMGGMAAQIPIKDDaAANEAALELVRKDKLREVRAGHDGTWAAHPGLIPAIREVFEGHL 394 Zea mays
XP_009125524 319 QHFMRSYSDLLIRTchkrgvHAMGGMAAQIPIRDDpKANEMALDLVKKDKLREVRAGHDGTWAAHPGLIPICMDAFSHMG 398 field mustard
P30952       316 SPFMDAYVKRLINTchrrgvHAMGGMAAQIPIKDDpAANEKAMTKVRNDKIRELTNGHDGSWVAHPALAPICNEVFIN-M 394 Saccharomyces c...
ESW97754     318 VPFMTNYVKQLIKIchkrgvHAMGGMAATIPIKDDpEKNAAAMEAVRQDKLREVLAGHDGTWIAHPGLLPTALSVFQEHM 397 Ogataea parapol...
P42450       499 APWKQAYENNNVDA------GIQRGLPGKAQIGKGmWAMTELMAEMLEKKIGQPREGANTAWVPSPTGATLHATHYHLVD 572 Corynebacterium...
1P7T_B       479 TPWIKAYERNNVLS------GLFCGLRGKAQIGKGmWAMPDLMADMYSQKGDQLRAGANTAWVPSPTAATLHALHYHQTN 552 Escherichia col...
P28344       307 VPFMDAYVKLLIKTchkrgvHAMGGMAAQIPIKDNaEANDKAMEGVRADKLREVRAGHDGTWVAHPALASIASEVFNKYM 386 Aspergillus nid...
EER32964     313 APFMSSYVKLLVHTthkrkvHALGGMAAQIPIKDDeARNRAALENVTKDKLREVTLGCDSCWVAHPALVPVVLKVFNEHM 392 Candida tropica...
3CV1_A       383 gSRKNQLEVMREQd-aPIT----ADQLLa--PCDG-------ERTEEGMRANIRVAVQYIEAWI-SGNGC--VPIYG--- 442 Escherichia coli
O32913       565 -VAAVQQELTGQR---RAT----VDQLLt--IPLAkklawapEEIREEVDNDCQSILGYVVRWVdQGIGCskVPDIHnva 634 Mycobacterium l...
EDY48984     390 gDRPHQKDRLREEv--SVT----AAELIavgSPAA-------RPTAAGLLNAVRVGIRYIEAWL-RGTGA--VAIFH--- 450 Streptomyces cl...
Q9RYN3       383 pQ-PNQIGSDKQKd-fSLT----ATDLLq--APEG-------SVTEAGVRTNINVGIQYLAAWL-RGSGA--VPIHN--- 441 Deinococcus rad...
P49081       395 gGRPNQIGDAAGHegaSVK----EEDLIq--PPRG-------ARTVDGLRLNVRVGVQYLAAWL-AGSGS--VPLYN--- 455 Zea mays
XP_009125524 399 -NNPNQIKSMKRDdasAIT----EEDLLq--IPRG-------VRTLEGLRLNTRVGIQYLAAWL-TGSGS--VPLYN--- 458 field mustard
P30952       395 -GTPNQIYFIPEn---VVT----AANLLetkIPNG-------EITTEGIVQNLDIGLQYMEAWL-RGSGC--VPINN--- 453 Saccharomyces c...
ESW97754     398 -PTPNQVHVQKNv---EIT----EADLVdtnIPDG-------KITMKGVSANIYIGLNYMESWL-RGLGC--VPINN--- 456 Ogataea parapol...
P42450       573 -VFKVQDELRAAGr--RDS----LRNILt--IPTApntnwseEEKKEEMDNNCQSILGYVVRWVeHGVGCskVPDIHdid 643 Corynebacterium...
1P7T_B       553 -VQSVQANIAQTEf--NAEfeplLDDLLt--IPVAenanwsaQEIQQELDNNVQGILGYVVRWVeQGIGXskVPDIHnva 627 Escherichia col...
P28344       387 -PTPNQMHVRREDv--NIT----ANDLLn-tNVPG-------KITEDGIRKNLNIGLSYMEGWL-RGVGC--IPINY--- 445 Aspergillus nid...
EER32964     393 -KGPNQISLPPKEpfkPIT----QRDLLspfVPGA-------KITEQGIRANIVIGISYIEAWL-RNVGC--VPINY--- 454 Candida tropica...
3CV1_A       443 LMEDAATAEISRTSIWQWIHHQKTLSNg---KPVTKALFRQMLGEEMKviaselgeerfSQGRFDDAarlme-qittSDE 518 Escherichia coli
O32913       635 LMEDRATLRISSQLLANWLRHGVITSEd---VRASLERMAPLVDQQNA-----------EDPAYRPM----------APN 690 Mycobacterium l...
EDY48984     451 LMEDAATAEISRSQIWQWINAGVVLENg---ERVTPALVRTLAAGELGalretlggeeyAAGRWQEAhdlll-rvalDEE 526 Streptomyces cl...
Q9RYN3       442 LMEDAATAEISRAQLWQWLKQGVTLEDg---RTLDQGLFDQLYTEETDkl----------gAEFADAsalfk-qtatGDT 507 Deinococcus rad...
P49081       456 LMEDAATAEISRVQNWQWLRHGAALDAggveVRATPELLARVVEEEMArveaevgpdrfRKGRYAEAgrifs-rqctAPE 534 Zea mays
XP_009125524 459 LMEDAATAEISRVQNWQWIRYGVELDGdglgVRVSKELFGRVVEEEMEriekevgkdkfKKGMYKEAckmft-kqctAAE 537 field mustard
P30952       454 LMEDAATAEVSRCQLYQWVKHGVTLKDt--gEKVTPELTEKILKEQVErlska--splgDKNKFALAakyfl-peirGEK 528 Saccharomyces c...
ESW97754     457 LMEDAATAEVSRLQLYSWCKHAVKMDDt--gKTITPEFISKLIDEEAErcaa-----nkpNNKFKIAadclkkeingHTE 529 Ogataea parapol...
P42450       644 LMEDRATLRISSQMLANWIRHDVVSKEq---VLESLERMAVVVDKQNA-----------GDEAYRDM----------APN 699 Corynebacterium...
1P7T_B       628 LMEDRATLRISSQHIANWLRHGILTKEq---VQASLENMAKVVDQQNA-----------GDPAYRPM----------AGN 683 Escherichia col...
P28344       446 LMEDAATAEVSRSQLWQWARHGVTTSEg---KKVDKAYALRLLKEQADalaa----kgpKGNKFQLAgryfa-gqvtGED 517 Aspergillus nid...
EER32964     455 LMEDAATAEVSRTQIWQWVTHGAKTDTg---KVITKDYVKQLLDEEYDklvk----nakPGNKFKRAfeyfa-pealGEK 526 Candida tropica...
3CV1_A       519 LIDFLTLPGYRLLA 532 Escherichia coli
O32913       691 FDDSIAFLAAQELI 704 Mycobacterium leprae TN
EDY48984     527 YADFLTLPAYERLt 540 Streptomyces clavuligerus
Q9RYN3       508 LVDFLTLPGYQQLA 521 Deinococcus radiodurans
P49081       535 LDDFLTLDAYNLIV 548 Zea mays
XP_009125524 538 LDDFLTLAVYDHIV 551 field mustard
P30952       529 FSEFLTTLLYDEIV 542 Saccharomyces cerevisiae S288C
ESW97754     530 VAEFLTTLLYDDIV 543 Ogataea parapolymorpha DL-1
P42450       700 YDASLAFQAAKDLI 713 Corynebacterium glutamicum ATCC 13032
1P7T_B       684 FANSXAFKAASDLI 697 Escherichia coli str. K-12 substr. W3110
P28344       518 YADFLTSLLYNEIS 531 Aspergillus nidulans FGSC A4
EER32964     527 YSDFVTTLIYDDVt 540 Candida tropicalis MYA-3404
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap