1O1R


Conserved Protein Domain Family
PPTA

?
pfam01239: PPTA 
Click on image for an interactive view with Cn3D
Protein prenyltransferase alpha subunit repeat
Both farnesyltransferase (FT) and geranylgeranyltransferase 1 (GGT1) recognize a CaaX motif on their substrates where 'a' stands for preferably aliphatic residues, whereas GGT2 recognizes a completely different motif. Important substrates for FT include, amongst others, many members of the Ras superfamily. GGT1 substrates include some of the other small GTPases and GGT2 substrates include the Rab family.
Statistics
?
PSSM-Id: 426146
Aligned: 619 rows
Threshold Bit Score: 24.1387
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1O1R_A       151 LQEEMNYITAIIEEQPKNYQVWHHRRVLVEWL 182 Norway rat
CEH13890      60 SLRALQLTKHLATLNASSYTVWAWRAKILSAD 91  Ceraceosorus bombacis
EEH51146      11 SERALRVTEHCIALNGADYTAW-HRRWVLISD 41  Micromonas pusilla CCMP1545
OAG30180      37 ITEHLFAMTLLLEYNPANYTLWVQRRDRLPEA 68  Nematocida displodere
EHY66213      46 STQALDIITSIIYYCPTNYTVWVDRRKVLGKI 77  Nematocida sp. 1 ERTm2
XP_009497661  83 SMRALLITSYAAIVCPSHYSVWQYRRKLLAQL 114 Fonticula alba
XP_003645689  76 SERALAVTTAMVEASPAYYTAWNYRYNIVKGL 107 Eremothecium cymbalariae DBVPG#7215
EDK39947      45 SPRALEWTSKAIDLLASHYTLWSYRFDIVCAI 76  Meyerozyma guilliermondii ATCC 6260
Q75C23        48 SARALALNSTALRMAPSDYTTWNHRYRLVKAL 79  Eremothecium gossypii
CEF99413      44 LARGMETSARVIETCGAHYTAWAHRWRCAEAL 75  Ostreococcus tauri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap