1LW4,3WLX


Conserved Protein Domain Family
Beta_elim_lyase

?
pfam01212: Beta_elim_lyase 
Click on image for an interactive view with Cn3D
Beta-eliminating lyase
Statistics
?
PSSM-Id: 426128
Aligned: 41 rows
Threshold Bit Score: 190.119
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1LW4_A         7 DLRSDTvtkPTEEXRKAX-AQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTXGNQVSIXAHTQRGDEVILEAD 85  Thermotoga mari...
WP_013068018  46 DLLTDS---GTGAMSSLQwAAVMQGDESYAGSPSFFRFEAAVQNLMPFKHIIPTHQGRAAEAILFSIFG----GKGRRIP 118 Rhodobacter cap...
Q9HMV2        42 DLLTDS---GTGTMSNDQwAAMLQGDEAYAGSASFEDLAVAAEDVMGFQHIIPAHQGRGAENVLYGAVL---------SA 109 Halobacterium s...
Q9YCI2        52 DLLTDS---GTGSMSIYQwAALMTGDEAYAGARSWFRFRDAVRDVLGLDLVLPVHQGRAAERILYGELLRR-------RN 121 Aeropyrum perni...
Q08897        47 DLLTDS---GTNAMSDRQwGALMMGDEAYAGARSFFRLEEAVREIYGFKYVVPTHQGRGAEHLISRILIKPGD----YIP 119 Symbiobacterium...
Q9CMK9        47 DLLTDS---GTSAMSDKQwAGLMIGDEAYAGSRNFMHLQDVVREYYGFKYVVPTHQGRGAENLLSTIMI---------KP 114 Pasteurella mul...
Q8RHM6        49 DLLTDS---GTNAMSDKQwGGLMQGDEAYAGSRNFFHLEETVKEIFGFKHIVPTHQGRGAENILSQIAIKPGQYV----P 121 Fusobacterium n...
Q894M8        60 DLLTDS---GTNAMSDDQwAGVMKGDEAYAGGKSYFKLVDAVKDIFGYKFVQPVHQGRAAEKVLFGLLL--------GEG 128 Clostridium tet...
Q8A7N2        47 DLITDS---GTGAMSDRQwAGMMLGDESYAGATSFFKLKDTITRITGFEYIIPTHQGRAAENVLFSYLV---------HE 114 Bacteroides the...
Q7MUT3        47 DLLTDS---GTGAMSDRQwSAMMLGDESYAGARSYYNMKNAIHDILGFDYFLPTHQGRAAENVLFSTIV---------KE 114 Porphyromonas g...
1LW4_A        86 -----SHIFWYEVGAXAVLSGVXPHPVP--GKN-----------GAXDPDDVRKAIRP--RnihfPRTSLIAIENTHNRS 145 Thermotoga mari...
WP_013068018 119 -----SNTHFDTTRGNIEASGAMGDDLV--IAEgkdpqslhpfkGNMDLARLEAYLAEh-----hAEVPLVMITITNNAG 186 Rhodobacter cap...
Q9HMV2       110 gdtvlNNAHFDTTRAHVAANDATPVDCP--VDGardpdtdapfkGNFSVERARRVVDDvgA----DAVPVVVLTITNNSM 183 Halobacterium s...
Q9YCI2       122 arivpANTHFDTGRAVILNQGGVPLDLP--SPQasrre-aypfkGDIDVARLERLLKErsR-----DVAFILLVITNNTA 193 Aeropyrum perni...
Q08897       120 -----GNMYFTTTRTHQELQGGTFVDVI--IDEahdpqashpfkGNVDIAKFEALIDRvgA----DKIPYINVALTVNMA 188 Symbiobacterium...
Q9CMK9       115 gdyvpGNMYFTTTRAHQERNGATFVDII--IDEahdsqidlpfkGNVDVKKLQKLIDEvgA----DKIPYICLAVTVNLA 188 Pasteurella mul...
Q8RHM6       122 -----GNMYFTTTRYHQERNGGIFKDII--RDEahdatlnvpfkGDIDLNKLQKLIDEvgA----ENIAYVCLAVTVNLA 190 Fusobacterium n...
Q894M8       129 ky-siSNMHFDTTRAHVELSGARAIDCV--VPEasdptvripfkGNMDVEKLEKLIKEhgA----DKIGVVVMTITNNSA 201 Clostridium tet...
Q8A7N2       115 gnivpGNSHFDTTKGH--IEGRHAIALDctIDEakntqleipfkGNVDPAKLEKALSEy-----aDRIPFIIVTITNNTA 187 Bacteroides the...
Q7MUT3       115 gdvlpGNSHFDTTKGHIEYRRAFAPDCT--IDEaadtqielpfkGNMDLNKLEKILKEtpK----EKIPCVVLTITNNTA 188 Porphyromonas g...
1LW4_A       146 GGRVVPLENIKEICTIAKEHGINVHIDGARIFNAS------------IASGVPVKEYAGYADSVXFCLSXGLCAPVGSVV 213 Thermotoga mari...
WP_013068018 187 GGQPVSLANIRAVADLAHRHGKPFVIDGCRFAENAwfiktreegqaeRSIPEIVRDCFAVADGMTMSAKKDAFGNIGGWL 266 Rhodobacter cap...
Q9HMV2       184 AGQPVSIENTREVAAFADDIDATFVIDACRFAENAhfvqqrepgyehDSVAAIAREQLSYADACVMSGKKDGLVNVGGFV 263 Halobacterium s...
Q9YCI2       194 GGQPVSMDNVKTVRELADAYGLPLVMDICRFAENAylvkerdpryrgWSVRDIAREMISYGDHFVMSAKKDGLANIGGFI 273 Aeropyrum perni...
Q08897       189 GGQPVSMANLREVRKVCDRHGIRMWSDATRAVENAyfikereegyqdKPVREILKEMMSYFDGCTMSGKKDCLVNIGGFL 268 Symbiobacterium...
Q9CMK9       189 GGQPVSMANMREVKALCSKHGIKVMFDATRCVENAyfikereaeykdATIKDILKEMMSYADGCTMSGKKDCLVNIGGFL 268 Pasteurella mul...
Q8RHM6       191 GGQPVSMKNMKAVRELTKKHGIKVFYDATRCVENAyfikeqeegyqdKTIKEIVHEMFSYADGCTMSGKKDCLVNIGGFL 270 Fusobacterium n...
Q894M8       202 GGQPVSIENMKETAEICKKYNIRLCIDAARYAENAyfikqrepgyenKSIKEIIKEIFSYADIFTMSAKKDAIVNMGGLL 281 Clostridium tet...
Q8A7N2       188 GGQPVSMQNLREVRAIANKYNKPVLFDSARFAENAyfikmrekgyqdKSIKEITREMFDLADGMTMSAKKDGIVNMGGFI 267 Bacteroides the...
Q7MUT3       189 GGQPVSMKNIREVSELTHRYGIRLLIDSARFAENAyfiktreagyenKSIKEIVKEIYSYADMMTMSSKKDAIVNMGGFV 268 Porphyromonas g...
1LW4_A       214 VGDRD------------------------------------------FIERARKARKXLGGGXRQAGVLAA--------- 242 Thermotoga mari...
WP_013068018 267 ALNDDdlaeearghlirtegfptygg-lagrdldalaqglveivdedYLRYRIRTHQYIVERLDAMGVPVVkpagghavf 345 Rhodobacter cap...
Q9HMV2       264 GLHDDgrlheqcrqrgilyegfstyggmsgrdmaafavglreaveppYVAERVAQVQRLADALTDRDVPIYqpagghavy 343 Halobacterium s...
Q9YCI2       274 ATRDPslyedlaarvvleegyvtygg-lagrdleaiaqglrevveedYLRHRVEQVRYLGELLSSQGVPIVepvgghavy 352 Aeropyrum perni...
Q08897       269 AMNEEwilqkareqvvifegmptygg-lagrdmeaiaqgiyemvdddYIAHRIHQVRYLGEQLLEAGIPIVqpigghavf 347 Symbiobacterium...
Q9CMK9       269 CINDDdlyqqacelvvlfegmpsygg-lagrdmeamaigitesvdfhYIQHRVAQCYYLADKLEAAGVPIVkpvgghavf 347 Pasteurella mul...
Q8RHM6       271 CMNDEdlflaakeivvvyegmpsygg-lagrdmeamaiglreslqyeYIRHRILQVRYLGEKLKEAGVPILepvgghavf 349 Fusobacterium n...
Q894M8       282 GIKEDeelfqlckgrtisfegfitygglsgrdleslaiglyegidenYLRYRIGQMEYLAARLDEAGIAYQspvgghgvf 361 Clostridium tet...
Q8A7N2       268 ATRRKewyegakgfcvqyegyltygg-mngrdmnalaigldentefdNLETRIKQVEYLAQKLDEYEIPYQrpagghaif 346 Bacteroides the...
Q7MUT3       269 AFKDEelfkrcqmfcimnegfitygg-msgrdmnalaqgldegtdfdTLETRIKQVEYLGKKLDEYGIPYQrpagghaif 347 Porphyromonas g...
1LW4_A       243 ---------------------------AGIIALTKXVDRLKEDHENARFLALKLKEIGY-SVNPEDVKTNXVILRTD 291 Thermotoga maritima
WP_013068018 346 idarawlshippleypgqalavalyelAGVRSCEIGTAMFGRQPD-GSEKPAAMDLVRLaFPRRTYTQSHADYIVEa 421 Rhodobacter capsul...
Q9HMV2       344 idanaalphlpreqfpgqafvcelyreGGVRAVELG--------RFAFPDTDRRDLVRLaLPRRTYGPDHLDHVADT 412 Halobacterium sali...
Q9YCI2       353 vdvlealpemprshypadalaaalyleSGVRAVGLGALAFARE-ENGEIVYPEFELLRLaVPRRTYTNSHMEYVAAS 428 Aeropyrum pernix K1
Q08897       348 ldaraflphipqdqfpaqalaaalyvdSGVRAMERGIVSAGRNPQTGEHNYPKLELVRLtIPRRVYTDRHMDVVAys 424 Symbiobacterium th...
Q9CMK9       348 ldakkflphipqeqfpaqmlaaqiyieGGVRSMERGIVSAGRDKKTGANHTPKLELVRLtIPRRVYTYAHLDHVADT 424 Pasteurella multoc...
Q8RHM6       350 ldarrfcphipqeefpaqalaaaiyveCGVRTMERGIISAGRDVKTGENHKPKLETVRVtIPRRVYTYKHMDVVAEg 426 Fusobacterium nucl...
Q894M8       362 vdaksmfphipynefpgqvlavelykeAGIRTCEIGSYMLGNDPDTGEQLKADFEFTRLaIARRVYTQAHIDIMADA 438 Clostridium tetani...
Q8A7N2       347 vdaskvlthvpkeefpaqtltvelyleAGIRGCEIGYILADRDPITHENRFNGLDLLRLaIPRRVYTDNHMNVIAAA 423 Bacteroides thetai...
Q7MUT3       348 ldakkiltnvpkeefiaqtlgvelyleAGIRGVEIGSILADRDPVTKENRYPRLELLRLaIPRRTYTNNHMDVIAAA 424 Porphyromonas ging...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap