6A5O


Conserved Protein Domain Family
RNA_pol_N

?
pfam01194: RNA_pol_N 
Click on image for an interactive view with Cn3D
RNA polymerases N / 8 kDa subunit
Statistics
?
PSSM-Id: 426114
Aligned: 98 rows
Threshold Bit Score: 45.5673
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6A5O_J         2 IIPVR-CFSCGKVVGDKWDAYLRLL-EEG-KQEGDALDELKLKRYCCRRMVLTHVDLIEKF 59  Komagataella phaffii GS115
Q8TVB4         2 IIPIR-CFTCGRPIAHLWEKYVELIeEEG-MEPGEALDELGVDRYCCRRMFLSHVDLLEES 60  Methanopyrus kandleri AV19
EAY16614       2 LIPVR-CFTCGAIIGHKWKEYVRLI-EEEhMNYTEALNALNLKRFCCRRMLLTHVDLLDRM 60  Trichomonas vaginalis G3
Q4DLU2         2 IIPVR-CFTCGNVIADKYLLYLDLV-AEG-VSEEAALDAFNLQRFCCRRMFLTHVDFSDLL 59  Trypanosoma cruzi
Q4CTY7         2 LIPVR-CYSCGKVIGNLYEKYQQLL-SED-YTEAEALNALQLDRMCCRRMILSHIDLVDEL 59  Trypanosoma cruzi
CAM39127       2 IIPVR-CYSCGKVVGNLYEQYQRLL-DQD-YTESEALDALHLDRYCCRRMILSHIDLIDDL 59  Leishmania braziliensis MHOM/BR/75...
XP_005328731  38 VIPVRcCFTYHKMVDNKCEATLGTL-QTQ-YTKGDALDALSLKLYCCHRMLLAQMDLTEKL 96  thirteen-lined ground squirrel
XP_003363363  14 IILVR-CFTCGTIICNKLEACLGLL-QAQ-YIKGAALDALGPKCICSHCMLLAHVHLTEWL 71  horse
ELK13595      27 IIPVC-CFIFGTFFSDKWEASLGLL-HTE-YTRGDALHILGLKYYYSYCMALAHRGLIKNL 84  black flying fox
XP_004987671   2 IIPVR-CFSCGKVIGNKYKRFLGFV-DAE-YGESKALDEVGLKRYCCRRMLLTHVDLIEKL 59  Salpingoeca rosetta
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap