6VTY,1UUM,5KSW


Conserved Protein Domain Family
DHO_dh

?
pfam01180: DHO_dh 
Click on image for an interactive view with Cn3D
Dihydroorotate dehydrogenase
Statistics
?
PSSM-Id: 426103
Aligned: 11 rows
Threshold Bit Score: 360.896
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6VTY_D  69 YACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLG-FSFIEIGTITPRGQTGNAKPRIFRDVESrsIINSCGFNNMGCDK 147 Plasmodium falciparum...
P32747 104 SLAVEVWGKKFCNPIGLAAGFDKQADAISGLLNFG-FSYLEIGSVTPKPQPGNPKPRYFRLKPDlsVINRYGFNSIGHDA 182 Schizosaccharomyces p...
1UUM_B  54 MLEVKVLGHKFRNPVGIAAGFDKNGEAVDGLYKLG-FGFVEVGSVTPQPQEGNPRPRVFRLPEDqaVINRYGFNSHGLSV 132 black rat
P74782  59 RLQQTCWGLNFPNVLGLSAGCDKEGEAAAVWPALG-FGFAELGAVTKYAQPGNDRPRLFRLPQDqaVLNRLGANNEGAVA 137 Synechocystis sp. PCC...
P46727  48 VLASTVFGVRFPGPLGLAAGFDKDGMGLLAWGALG-FGYAEVGTVTAYPQPGNPAPRMFRLPADraLLNRMGFNNNGAGA 126 Mycobacterium leprae TN
P28272   4 SLTTKFLNNTYENPFMNASGVHCMTTQELDELANSkAGAFITKSATTLEREGNPEPRYISVPLG--SINSMGLPNEGIDY 81  Saccharomyces cerevis...
Q9CFC9   1 MLKTTFANAEFANPFMNASGVHCMTTEDLEELKASqAGAYITKSSTLEKREGNPLPRYVDLELG--SINSMGLPNLGFDY 78  Lactococcus lactis su...
Q58070   5 MLKTNICGIEFKNPVFLASGIMGETGSALKRIAKGgAGAVTTKSIGLNPNPGHKNPTIVEVYGG--FLNAMGLPNPGVDE 82  Methanocaldococcus ja...
P25996   1 MLEVKLPGLDLKNPIIPASGCFGFGKEFSRFYDLScLGAIMIKATTKEPRFGNPTPRVAETGAG--MLNAIGLQNPGLDS 78  Bacillus subtilis sub...
P0DH74   5 pLAVSIPGLTLKNPIIPASGCFGFGEEYANYYDLDqLGSIMIKATTPQARYGNPTPRVAETPSG--MLNAIGLQNPGLEV 82  Enterococcus faecalis...
5KSW_A   2 rLSVKLPGLDLKNPIIPASGCFGFGEEYAKYYDLNkLGSIMVKATTLHPRFGNPTPRVAETASG--MLNADGLQNPGLEV 79  Lactococcus lactis
6VTY_D 148 VTENLILFRKRQEEdkl--------------------------lskHIVGVSIGKNKDtv--niVDDLKYCINKIG--RY 197 Plasmodium falciparum...
P32747 183 ILAKIQKRVRKYIAktspqllkqfdanpasctdpavlgvprslipnKFLGINLGKNKNgn---eIEDYVEGVRTFG--NF 257 Schizosaccharomyces p...
1UUM_B 133 VEHRLRARQQKqaqlt--------------------------adglP-LGINLGKNKTse--daAADYAEGVRTLG--PL 181 black rat
P74782 138 MAAKLKHTWDYYPRt-------------------------------IPIGINLCKSKItpldqaVEDYVFSFQTLA--PV 184 Synechocystis sp. PCC...
P46727 127 LAIQLAHHRPEv----------------------------------P-IGVNISKTKAtpashtVDDYRASARLVG--PL 169 Mycobacterium leprae TN
P28272  82 YLSYVLNRQKNYPD---------------------------------APAIFFSVAGMs-----IDENLNLLRKIQdsEF 123 Saccharomyces cerevis...
Q9CFC9  79 YLDYVLKNQKEKAQ---------------------------------EAPIFFSIAGMs-----AAENIAMLKKIQesNF 120 Lactococcus lactis su...
Q58070  83 YLEEIEKVRDELNR--------------------------------MDVRIIGSIYGKd-----EEEFAEVAKKME--RY 123 Methanocaldococcus ja...
P25996  79 VLHHELPWL-EQF----------------------------------DTPIIANVAGSq-----VDDYVEVAEHISkaPN 118 Bacillus subtilis sub...
P0DH74  83 VMQEKLPKLEKYP----------------------------------NLPIIANVAGAc-----EEDYVAVCAKIGqaPN 123 Enterococcus faecalis...
5KSW_A  80 IMAEKLPWLNENFP---------------------------------DLPIIANVAGSe-----EDDYVAVCAKIGdaPN 121 Lactococcus lactis
6VTY_D 198 ADYIAINVSSPNTP-GLRDNQEAGKLKNIILSVKEEIDnleknnimndestynednkivekknnfnknnshmmkdakdnf 276 Plasmodium falciparum...
P32747 258 ADILVINVSSPNTP-GLRNLQKKSALSTLLTAVVSERNkln--------------------------------------- 297 Schizosaccharomyces p...
1UUM_B 182 ADYLVVNVSSPNTA-GLRSLQGKTELRHLLSKVLQERDalk--------------------------------------- 221 black rat
P74782 185 ADYFVVNVSSPNTP-GLRSLQESDELPRIFAGLQSANHw----------------------------------------- 222 Synechocystis sp. PCC...
P46727 170 ASYLVVNVSSPNTP-GLRDLQAVESLRAILLGVLAETS------------------------------------------ 206 Mycobacterium leprae TN
P28272 124 NGITELNLSCPNVP-GKPQVAYDFDLTKETLEKVFAFF------------------------------------------ 160 Saccharomyces cerevis...
Q9CFC9 121 SGITELNLSCPNVP-GKPQLAYDFEATEKLLKEVFTFF------------------------------------------ 157 Lactococcus lactis su...
Q58070 124 VDIIELNISCPHAKgYGATIGQNPDLSYDVCKAVKKAV------------------------------------------ 161 Methanocaldococcus ja...
P25996 119 VHALELNISCPNVKtGGIAFGTNPEMAADLTKAVKEVS------------------------------------------ 156 Bacillus subtilis sub...
P0DH74 124 VKAIELNISCPNVKhGGIAFGTDPEVAFQLTQAVKKVA------------------------------------------ 161 Enterococcus faecalis...
5KSW_A 122 VKVIELNISCPNVKhGGQAFGTDPDVAAALVKACKAVS------------------------------------------ 159 Lactococcus lactis
6VTY_D 277 lwfnttkkKPLVFVKLAPDLNQEQKKEIADVLL-ETNIDGMIISNTTTQIN--DIKSFENKK------GG-VSGAKLKDI 346 Plasmodium falciparum...
P32747 298 ------spHPPVLVKIAPDLNEEELTDIADVLK-KCKIDGVIVGNTTVQRPk-TLKSTSHVEe-----TGgLSGPPLKPI 364 Schizosaccharomyces p...
1UUM_B 222 -----gtrKPAVLVKIAPDLTAQDKEDIASVAR-ELGIDGLIVTNTTVSRPv-GLQG-ALRSe-----TGgLSGKPLRDL 288 black rat
P74782 223 --------QKPLLVKISPDLSWEAIAVIIDLVK-EHNLSGIVATNTSTRRSglKTKILPQTGqpieqeAGgLSGQPIRDR 293 Synechocystis sp. PCC...
P46727 207 ---------VPVLVKIAPDISDSEIDDITDLAV-ELRLAGIVATNTTVSRD--CLVT-PGIDal---gAGgISGPPVARR 270 Mycobacterium leprae TN
P28272 161 --------KKPLGVKLPP-YFDFAHFDIMAKILnEFPLAYVNSINSIGNGLfiDVEKESVVVkpk-ngFGgIGGEYVKPT 230 Saccharomyces cerevis...
Q9CFC9 158 --------TKPLGVKLPP-YFDLVHFDIMAEILnQFPLTYVNSVNSIGNGLfiDSEAESVVIkpk-dgFGgIGGAYIKPT 227 Lactococcus lactis su...
Q58070 162 --------KIPVFAKLTPNVTDIIEIAQAVVDAgVDGLVAIN----TVRGMaiDIRAKKPILan---kFGgLSGKAIKSI 226 Methanocaldococcus ja...
P25996 157 --------DVPVYVKLSPNVANITEIALAIEEAgADGLTMIN----TLIGMrlDLKTGKPILan---kTGgLSGPAVKPV 221 Bacillus subtilis sub...
P0DH74 162 --------SVPIYVKLSPNVTDIVPIAQAIEAGgADGFSMIN----TLLGMriDLKTRKPILan---qTGgLSGPAIKPV 226 Enterococcus faecalis...
5KSW_A 160 --------KVPLYVKLSPNVTDIVPIAKAVEAAgADGLTMIN----TLMGVrfDLKTRKPVLan---iTGgLSGPAIKPV 224 Lactococcus lactis
6VTY_D 347 STKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLL 412 Plasmodium falciparum 3D7
P32747 365 ALNTLRTLRKHLSSDIPIIGCGGISSGKDAIEYARAGATMVQVYTALGYDGPVIAHKIKQEILAEL 430 Schizosaccharomyces pombe 972h-
1UUM_B 289 STQTIREMYALTQGRIPIIGVGGVSSGQDALEKIQAGASLVQLYTALIFLGPPVVVRVKRELEALL 354 black rat
P74782 294 ATEVIRYIYQQTGGTIPIIGVGGIFTAEDAWEKIQAGASFLQIYTGWIYGGPWVVSDILQGLGEKL 359 Synechocystis sp. PCC 6803 substr. ...
P46727 271 AVEVLRRLYGRVGDRLVLISVGGIETADDAWDRITAGASLLQGYTGFIYGGGFWPKHIHDGIARRL 336 Mycobacterium leprae TN
P28272 231 ALANVRAFYTRLRPEIKVIGTGGIKSGKDAFEHLLCGASMLQIGTELQKEGVKIFERIEKELKDIM 296 Saccharomyces cerevisiae S288C
Q9CFC9 228 ALANVRAFYTRLKPEIKIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIM 293 Lactococcus lactis subsp. lactis Il...
Q58070 227 GIKVVWDLYENFD--VPIIGVGGIMSGEDAIEYMMAGASAVQIGSGVYYRGYDIFKKVCDEIISFL 290 Methanocaldococcus jannaschii DSM 2661
P25996 222 AIRMVYEVSQMVN--IPIIGMGGVQTAEDALEFLLAGASAVAVGTAN-FVNPFACPEIIEQLPSVL 284 Bacillus subtilis subsp. subtilis s...
P0DH74 227 AIRLIRQVASVSQ--LPIIGMGGVQTVDDVLEMFMAGASAVGVGTAN-FTDPYICPKLIDGLPKRM 289 Enterococcus faecalis V583
5KSW_A 225 ALKLIHQVAQVVD--IPIIGMGGVESAQDVLEMYMAGASAVAVGTAN-FADPFVCPKIIEKLPEVM 287 Lactococcus lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap