Conserved Protein Domain Family
Glypican

?
pfam01153: Glypican 
Glypican
Statistics
?
PSSM-Id: 426084
Aligned: 15 rows
Threshold Bit Score: 627.478
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_005802141  14 ALSGTRSPAAAA-GRSCADTRQVYSEKGY-STSTAPVTQISGEHLRLC-PQDYTCCSSQMEETLSLQSERDFLKATEDNS 90  southern platyfish
XP_006637812  13 ATPIVGENTSGK-ARSCSDVRQFYSGKGF-HLVGVPQTEISGEHLRIC-PQGYTCCTSEMEESLSTLSRREFEGLVKEAG 89  spotted gar
F1QCC6        14 SVSLSAENAGGK-ARSCTDVRQFYSGKGF-TLNGVPQSEISGEHLRIC-PQGYTCCTSAMEETLSNLSRREFEGLVREAG 90  zebrafish
XP_014347969  17 SSVCTGSPTS-K-PKSCSEVRQLYNSKGY-SLNGVPHTEISGEHLRVC-PQGYTCCTSEMEENFASLSRRELEGKVKEAG 92  coelacanth
Q5RE54        21 A------GADVK-ARSCGEVRQAYGAKGF-SLADIPYQEIAGEHLRIC-PQEYTCCTTEMEDKLSQQSKLEFENLVEETS 91  Sumatran orangutan
XP_001514704  15 ALSLSPLAAEPK-SKSCSEVKRLYVSQGF-NKNDAPSHEINGDHLKVC-PQGYTCCSQEMEEKYSQQSKDDFRGSVGEHC 91  platypus
1_pfamImport   6 S---VSMTAEQK-LKNCNDVRAAYSSKGF-NVNDVPNKGVNGAPLKVC-PQGFSCCTVEMEEKLSQQSHTEIKAPVSKLS 79 
AAK69693      17 A----SAQADQK-SKNCNEVRTAYSSKGF-NVNDVPNKGVQGAHLKVC-PQGFSCCTLEMEEKLSQLSRVDLKVPVHQLS 89  zebrafish
Q24114        53 QRDSRAKDAVGGsTHQCDAVKSYF------ESIDIKSSGTYSEKGAIC---GGNCCNNATELELRDKAAGMFEQLLHHHT 123 fruit fly
XP_509696     17 ALVGSARSEGV---QTCEEVRKLFQWRLLgAVRGLPDSPRAGPDLQVCiSKKPTCCTRKMEERYQIAARQDMQQFLQTSS 93  chimpanzee
XP_005802141  91 QFLLTTFTQRHRRFDEFFRELIDLSEKSMNQMFTKTYGRLFTQNTHVFQELFVELRRY------YSGGS--V-------- 154 southern platyfish
XP_006637812  90 HSLQLSLTTQYKSFDGYFLDLLNQSERSLQDSFPAVYGELYTQNARLFKDLYAELRRY------YRGSN--I-------- 153 spotted gar
F1QCC6        91 RSIQALLNAQYRTFDTYFLELLNGSERWLEEAFVAALGELYRLNAGVFRDLYAELHRY------YSGAS--L-------- 154 zebrafish
XP_014347969  93 RSIQASLNTQYKNFDGYFQEVLNRSESSLHEAFLGLYGDLYTQNTQLFKELYGELRRY------YHGSN--I-------- 156 coelacanth
Q5RE54        92 HFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRY------YTGGN--V-------- 155 Sumatran orangutan
XP_001514704  92 NLLQTTFGSRYKKFDEFFKELLENAEKSLNDMFVRTYGRLYMQNSELFKDLFVELKRY------YVGGN--V-------- 155 platypus
1_pfamImport  80 TNLQSTFRQRHDHFDKFFRELLKNAHGSLHNMFARTYGMMYMRNSELFDNFFKALKRY------YVSGSaaV-------- 145
AAK69693      90 SNLQSTFTQRHRHFDQFFRELLDNAEKSLNHMFVRTYGLMYVKNKELFEGFFSDLRRY------YSHGSseV-------- 155 zebrafish
Q24114       124 SSLRGVLETNAKQFQSHVLELAQISENMTHSLFSKVYTRMVPSSRMMIHQLYTEIMNHliytsnYTNSNgqLgrrgigsv 203 fruit fly
XP_509696     94 STLKFLISRNAAAFQETLETLIKQAENYTSILFCNTYRNMALEAAASVQEFFTDVGLY------LFGAD--V-------- 157 chimpanzee
XP_005802141 155 --SLTEVFSDFWSGLVERVF-SLVNPQYQ--FSD---DYLECVSKHTEQLQPFGDVPRKLRVQVSRAFIAARALSQGLAF 226 southern platyfish
XP_006637812 154 --NLEEVLNEFWVRLLERLF-KAQNPQYV--FGD---EYLECAVKQTETLRPFGDVPRELKLKATRAFIAARSFVQGLGV 225 spotted gar
F1QCC6       155 --NLEEALDEFWMKLLERLL-KASDPETAslLSD---DFLDCASKQTETLRPFGDAPRELKAKLVRAFIAARAFVQGLNA 228 zebrafish
XP_014347969 157 --NLEEALTEFWTRLLERIF-KQLNPQYQ--LTD---EYLDCALKQAEQQRPFGETPRELKARATLAFIAVRSFIQGLSM 228 coelacanth
Q5RE54       156 --NLEEMLNDFWARLLERMF-QLINPQYH--FSE---DYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTV 227 Sumatran orangutan
XP_001514704 156 --NLEEMLNDFWARLLERMF-RLVNPQYH--FTD---EYLECVSKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGLAV 227 platypus
1_pfamImport 146 --NLDSMLSDFWADLLERMF-GLVNVQYE--FSP---AYMECVSQHTEQLQPFGDVPRKLRIQLTRAFVAARTFVRGLTL 217
AAK69693     156 --NLDDMLAEFWSELLERMF-RLVNVQYE--FSD---SYMECVSRHTDQLKPFGDVPRKLRLQLTRSFIAVRAFTRGLTL 227 zebrafish
Q24114       204 qsNLEEAVRHFFVQLFPVAYhQMVHLSKNn-LGDlheDYVNCLQHNFDEMHPFGDIPQQVQSNLGKSVHMSNVFMNALLQ 282 fruit fly
XP_509696    158 --NPEEFVNRFFDSLFPLVYnRLINPA----VTDsslEYSECIRMARRDVSPFGNIPKRVMGQMGRSLLPSRTFLQALNL 231 chimpanzee
XP_005802141 227 GRDMVNTATKL---TADSECVRGLMRQWYCSLCRGLPF-----LRPCHSLCLNVMKGCLANQAE-LDTEWNNFIDAL-YV 296 southern platyfish
XP_006637812 226 SSEVVRKVSQV---PLSPECTRALMKLMYCPHCRGMPS-----VKPCINYCRNVMKGCLANQAD-LDTEWRNLIESM-LQ 295 spotted gar
F1QCC6       229 AGEIVRKVSQV---PLSPECNRAIMKLVYCPHCRGLGS-----VKPCINYCKNVMKGCLANQAD-LDTEWQSLIETM-LQ 298 zebrafish
XP_014347969 229 ASDVVRRVSQV---PLSPECTRAIMKLLYCPHCRGMSS-----VKGCQNYCHNVMKGCLANQAD-LDTEWRAFVDAM-LQ 298 coelacanth
Q5RE54       228 GREVANRVSKV---SPTPGCIRALMKMLYCPYCRGLPT-----VRPCNNYCLNVMKGCLANQAD-LDTEWNLFIDAM-LL 297 Sumatran orangutan
XP_001514704 228 ARDVVNKVSVV---NPTPSCTHALLKMMYCPHCRGLVT-----VKPCYNYCSNVLRGCLANQGD-LDSEWNHFIDAM-LM 297 platypus
1_pfamImport 218 LPEVVNKVSMV---SASPSCVRASMKMLYCPYWSGQVA-----LKPCQNYCLNVLRGCLANQAD-LDAEWNNFLDAM-LS 287
AAK69693     228 MPDVVRKVSTV---SASPSCVRASMKMLYCPYCSGQVA-----LKPCKNYCLNVMRGCLANQAD-LDTEWNNFLDSM-LG 297 zebrafish
Q24114       283 AAEVLSEADALygeQLTDTCKLHLLKMHYCPNCNGHHSssrseTKLCYGYCKNVMRGCSAEYAGlLDSPWSGVVDSLnNL 362 fruit fly
XP_509696    232 GIEVINTTDYL---HFSKECSRALLKMQYCPHCQGLTL-----TKPCMGYCLNVMRGCLAHMAE-LNPHWHAYIRSL-EE 301 chimpanzee
XP_005802141 297 VSEKLEGPFNFELAADSISVKVSEAIMHMQENSVSISRKVFQGCGNPSPa---RNKRSPSESGGNRKPFRTYtpeekpTT 373 southern platyfish
XP_006637812 296 VADRFNGPSSVEVVIGSIHTRISEAMVNMLDNSAHFTSKVFQACGTPRV----GGTQVSGSEDKKKRGKSPV------DE 365 spotted gar
F1QCC6       299 VASSFGAEPSMDTVIYSIPVRISEAVLAMQENMEIYTSKVFKACGDRGE----EGTPSSISEEPKKKERTVTaleykpSP 374 zebrafish
XP_014347969 299 VSDRFEGTSSVETVFGSIHVRISEAIFNLQENEEHIRAKVFQACGNPKA-----NSRGSEGNEKKRM-KPVSd-----DT 367 coelacanth
Q5RE54       298 VAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPapalRSARSA-PENFNTR-FRPYnpeerpTT 375 Sumatran orangutan
XP_001514704 298 VAERLEGPFNIESVMDPIDVKISDAIMNMQENSMQVSQKVFQGCGPPKPlspgRSSRSVSESGFSAR-FRPYnpeerpTT 376 platypus
1_pfamImport 288 LADRLEGPFNFESVVEPIDVKISEAIMNMQENSMQVSQKVFQGCGQPKPsv-gRSKRSIKDTGFNGR-FRPYspdarpTT 365
AAK69693     298 LAERLEGPFNFESVVDPIDVKISDAIMNMQENSMQVSQKVFQGCGQPKLsmgfRSRRSAKDSGFPGR-FRPYspearpTT 376 zebrafish
Q24114       363 VTTHILSDTGIINVIKHLQTYFSEAIMAAMHNGPELEKKVKKTCGTPSLtpysSGEPDARPpph------------knNV 430 fruit fly
XP_509696    302 LSDAMHGTYDIEHVLLNFHLLVNDAVLQAHLNGQKLLEQVNRICGRPVRtp-tQSPRCSFDQSKEKHGMKTTtrnseeTL 380 chimpanzee
XP_005802141 374 AAGTNLDRLVTELKERLRPMRGFWVSLPHTICNdERMAADVTNEDR-CWNGQT-RGRYLPDVTGNGLASQINNPEVEVDI 451 southern platyfish
XP_006637812 366 KAGLGLEKLVSDVTGKLREMQQYWVQLPNALCT-DKVSAAPASEDK-CWNGMS-RASYLPEVMGDGLASQINNPEVEIDI 442 spotted gar
F1QCC6       375 KSAARLEVQVTDVYSKLKEMQLYWIQLPSALCS-GK-TASSTTGDK-CWNGIT-KASYLPEVMGDGLANQINNPEVEIDI 450 zebrafish
XP_014347969 368 SAGHRLEKLVLDVKGKLGEMKHYWVALPSALCG-NKITAGPTNEDR-CWNGMT-KSRYLPEVMGDGLANQINNPEVDVDI 444 coelacanth
Q5RE54       376 AAGTSLDRLVTDIKEKLKLSKKVWSSLPYTICKdESMTAGTSNEEE-CWNGHS-KARYLPEIMNDGLTNQINNPEVDVDI 453 Sumatran orangutan
XP_001514704 377 AAGTSLDRLVTDVKEKLKQAKKFWSSLPSNVCNdEKMAAGNVNEDE-CWNGNA-QSRYLFAVTGNGLANQGNNPEVEVDI 454 platypus
1_pfamImport 366 AAGTSLDRLTNDVKKKLKNAKKFWSTLPETVCAgERIEPG----DD-CWNGTA-KSRYESVVIGNGLANQVSNPDVDVDI 439
AAK69693     377 AAGTTLDRLLTDVKKKLKHAKKFWSTLPDTVCVgERIAPS----DD-CWNGTA-KSRYESVVMSSGLANQVSNPDVEVDI 450 zebrafish
Q24114       431 KWATDPDPGMVLFLSTIDKSKEFYTTIVDNFCDeQQHSRD----DHsCWSGDR-FGDYTQLLINPGTDSQRYNPEVPFNA 505 fruit fly
XP_509696    381 ANRRK------EFINSLRLYRSFYGGLADQLCAnELAAAD----GLpCWNGEDiVKSYTQRVVGNGLKAQSGNPEVKVKG 450 chimpanzee
XP_005802141 452 ARPDVKVKQLIVDLKVVTNKLKHAER-------------GQDINFI----DSEEGS--GSGGGdhderysddwpgyGPHS 512 southern platyfish
XP_006637812 443 TKPDMTIRQQIMQLKIMTNRLRNAFN-------------GNDVDFQ----DTSDDVs-GSGSG-------------ACVE 491 spotted gar
F1QCC6       451 TKPDRTIRQQIMLLKIMSNRLKNALE-------------GNDVDFQ----DTSDDFs-GSGSG-------------MCAD 499 zebrafish
XP_014347969 445 TKPDMMIRQQIMQLKIMTNRLRNAYK-------------GNDIDFL----DSSDDIs-GSGSAd------------GCPE 494 coelacanth
Q5RE54       454 TRPDTFIRQQIMALRVMTNKLKNAYN-------------GNDVNFQ----DTSDESs-GSGSGs------------GCID 503 Sumatran orangutan
XP_001514704 455 TKPDMVIRQQIMALRVMTIKMKNAYN-------------GNDVDFI----DISDESs-GEESGs------------GCES 504 platypus
1_pfamImport 440 TKPNIVIRSQIAALKEMTSWLKAAHS-------------GNDISVD----NDEDGSg-GEESGs------------GCDS 489
AAK69693     451 TKPDMVIRRQIAVLKEMTSWLKAAYT-------------GNDISFT----SDDAGS--GEESGs------------GCDS 499 zebrafish
Q24114       506 KAQTGKLNELVDKLFKIRKSIGAAAP-------------SNSIQATh---DIQNDMgeGSGGGegqigddeeeyggAHGS 569 fruit fly
XP_509696    451 TDP--VISQIIDKLKHVVQLLQGRSPkpdkwellqlgsgGGMVEQVsgdcDDEDGCg-GSGSGe---------------- 511 chimpanzee
XP_005802141 513 PPYSKTPRNPV----SNPAKPTRGreRNGSKWSRNHGQGRIKASAtsphlhiSSLVPLLS 568 southern platyfish
XP_006637812 492 ELCPRSTDRNTipntDQPIQYAIP--AENKKVVKGTASQALPHST-------LLLLSLAV 542 spotted gar
F1QCC6       500 HLCVRGRPPVFgpktDRPKLYATG---PENKRVKGSGNQIQPSF--------ILLIVFFV 548 zebrafish
XP_014347969 495 ETCKGSRKKVIlsvaGQPKVLTRP---LGTGSQGGGGGMALPSALtltlswaVTLahylw 551 coelacanth
Q5RE54       504 DVCPTEFEFVTt---EAPA-------VDPDRREVDSSAAQRGHSLl-----sWSLTCIVL 548 Sumatran orangutan
XP_001514704 505 PQCASEFVFNVtdnaGKPQ-------NSDRNTKDSSSASTVGPSRvavifgiMFLVmqrq 557 platypus
1_pfamImport 490 PSCESDPDIYF----STPPNPGKPaiEEKVKGINPSDGGVASKGSm-----aLALCGLAL 540
AAK69693     500 PSCEGDGDIYF----STPA-PGKPriLKTQEVEQASSGTRLAPCSl-----aLALASLLL 549 zebrafish
Q24114       570 GDGSGDGP-------HTPIEESEGttTNEVESRDSGKTSGSNPLEgtatwmlLTLVTMLF 622 fruit fly
XP_509696    512 --VKRTLKITDwmpdDMNFSDVKQihQTDTGSTLDTTGAGCAAATesmtftlISVVMLLP 569 chimpanzee
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap