6BFS


Conserved Protein Domain Family
GM_CSF

?
pfam01109: GM_CSF 
Click on image for an interactive view with Cn3D
Granulocyte-macrophage colony-stimulating factor
Statistics
?
PSSM-Id: 144630
View PSSM: pfam01109
Aligned: 7 rows
Threshold Bit Score: 218.178
Threshold Setting Gi: 117562
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6BFS_C   1 APARSPSPSTQPWEHVNA-IQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTM 79  human
Q29118  18 APTRPPSPVTRPWQHVDA-IKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTL 96  pig
P11052  18 APTRPPNTATRPWQHVDA-IKEALSLLNHSSDTDAVMN-DTEVVSEKFDSQEPTCLQTRLKLYKNGLQGSLTSLMGSLTM 95  cattle
P48749  18 APTRSPTLVTRPSQHVDA-IQEALSLLNNSNDVTAVMNKAVKVVSEVFDPEGPTCLETRLQLYKEGLQGSLTSLKNPLTM 96  dog
Q60481  18 APTDLLSPVTQSWKHVDAtINEALSLLNHTSDPAAVMNETVEVVYDQFEPQEPTCLQTRLALFMKGLRGNLTRLEGSLTL 97  domestic guinea pig
P48750  18 APTRSPNPVTRPWKHVDA-IKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTM 96  Norway rat
P01587  18 APTRSPITVTRPWKHVEA-IKEALNLLD---DMPVTLNeEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNM 93  house mouse
6BFS_C  80 MASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCW 122 human
Q29118  97 LAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCW 139 pig
P11052  96 MATHYEKHCPPTPETSCGTQFISFKNFKEDLKEFLFIIPFDCW 138 cattle
P48749  97 MANHYKQHCPPTPESPCATQNINFKSFKENLKDFLFNIPFDCW 139 dog
Q60481  98 MANFYKQHCPPTPETSCMTQIITFKSFKENLKRFLFAIPFDCW 140 domestic guinea pig
P48750  97 IASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCW 139 Norway rat
P01587  94 TASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECK 136 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap