5OPT


Conserved Protein Domain Family
Ribosomal_S19e

?
pfam01090: Ribosomal_S19e 
Ribosomal protein S19e
Statistics
?
PSSM-Id: 426041
Aligned: 151 rows
Threshold Bit Score: 148.741
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5OPT_o        22 TMKDVHPWRWVKLCSQHFKQEGKLMVPNCTEIVKSSHGRERAPQNPDWYYIRCAAILRAVYM-------RP--GVGYGGL 92  Trypanosoma cru...
EAY00854      12 QAREIAADVFVNALAKHFQENRIVKPPEWADLVKTAALKQMAPSNQNWFYTRAAAVIRQIYM-------HH--DASLSGL 82  Trichomonas vag...
Q4MYX5        27 SLKDCNPDLFVKAFAEHMKLKGYLECPKRLDYAKTSVAKELAPQDPDWFYIRAAAVLRHLYF-------HP--DSGVDRL 97  Theileria parva
XP_001611246  27 SLNDCQPDVFIAAFAQQMELKNYIDPPKWIDYVKTSCAKELAPQDPKWFYIRSAAILRHLYF-------HP--DEGIGRL 97  Babesia bovis T2Bo
Q5CSY3        18 TAKDVPAGILIEKFAQQLKKGGKMTMPEWVDHVKTASSKELPPQNSDWLYIRAASILRHLYV-------RP--NVGVGAL 88  Cryptosporidium...
EHY66381       2 KVEEICPEQFINVLSKSLKEEKKIERPAEADHIKTGHGREQAPVSEDWYHVRAASLLRKLYMeeltnpeKSkyGFGVMWF 81  Nematocida sp. ...
ELA46206       4 RIYQVDPTSFIGTLSSHLKNNNLLTQPQNIDIIKSCSGKQNAPLDPDWLYVRAASVYRHFLTah---fkNE--RITVTRL 78  Vavraia culicis...
ELQ74153       4 RIYQVEPSSFITTLSSHLKNNNLLTLPPNIDIVKSCSGKQNAPLNPDWLYVRAASVYRHFLTaq---ikNE--RITITRL 78  Trachipleistoph...
Q8SQS8         4 GIYEVMPEKFNEALKSYLKSTNEVVPLQDHDIMKTGEGREQAPIEEDWYFTRMASIVRQISI-------KG--AVTSEFL 74  Encephalitozoon...
XP_007604589   3 SVYRVKATPLIEAIKEILKSKSEIVLPENGDLIKTSHGKQYSPDDQHWFYTRMASIVRTAMC-------KG--TVSLKGL 73  Vittaforma corn...
5OPT_o        93 SKRFSNKKNRGSRPEITVRASKGLLHWGCKSLTKLGLI--EKCESSGHRITKNGRKLADAIAFKVAIR 158 Trypanosoma cruzi strain CL...
EAY00854      83 AFHYGANLKAVTMPKHHHNASRKVIRSILQQLEKADLV---KVGEKGRQLTPKGQRLLDQVATSCGKK 147 Trichomonas vaginalis G3
Q4MYX5        98 RKVYSSKKRNGSAPNHTCRASGKILRTIVQQLESIGFLe-QDLKKHGRRLSRKGCNTVNAFARQLTRE 164 Theileria parva
XP_001611246  98 RRVYASRKRRGCAPNHTCPASGKIIRTIVQQLEANGFLe-KSKDNKGRRLSRRGCNIVNEFARHLTRS 164 Babesia bovis T2Bo
Q5CSY3        89 SKFYGRKQRNGTARNHSAVASRGIIRYCLIQLQSLGLVe-FNPNTGTRRLSPQGQRELDSIARQC-KA 154 Cryptosporidium parvum
EHY66381      82 ARVYGGAKNNGHKPSHTVSGSKSLVRRILQSLENVKLV--STMPKGGRKLTQTGHAYLQEIAGKATTA 147 Nematocida sp. 1 ERTm2
ELA46206      79 ASLYGCKKDRGSRPGKKVRASKGHLRSIVRDFGKLGWL---VEDDKGKFVSEDGIKLSEQLIEKI-LS 142 Vavraia culicis subsp. flor...
ELQ74153      79 ASVYGCKKDRGSRPGKKVRAGRTHLRSILRDFGRLGWI---VEDERGKTVSEDGVRLSEQLIEKI-LS 142 Trachipleistophora hominis
Q8SQS8        75 AKRYGSLKNRGCRPSKYVGAYPEIGESVLENLKNMGWIneH----PKDMLTEKGKTIVREIIEKV-RE 137 Encephalitozoon cuniculi GB-M1
XP_007604589  74 SRKHSCRKNVGVRPTKYAKGSEFVNQSAVEQLIKIGWF---DFSNKKDVLTSSAKEILGEILEKVGQQ 138 Vittaforma corneae ATCC 50505
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap