Conserved Protein Domain Family
MannoseP_isomer

?
pfam01050: MannoseP_isomer 
Mannose-6-phosphate isomerase
All of the members of this Pfam entry belong to family 2 of the mannose-6-phosphate isomerases. The type II phosphomannose isomerases are bifunctional enzymes. This Pfam entry covers the isomerase domain. The guanosine diphospho-D-mannose pyrophosphorylase domain is in another Pfam entry, see pfam00483.
Statistics
?
PSSM-Id: 426015
Aligned: 8 rows
Threshold Bit Score: 271.599
Created: 16-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P26340 326 GVKDLVVVQTKDAVLIADRHAVQDVKKVVEKIKADGRHEHHMHREVYRPWGKYDSIDAGERYQVKRITVKPGEGLSVQMH 405 Salmonella enterica s...
Q2RMK3 324 GLCNVVVVATDDAVLVIDRGKVQDVKQIVERLKKANRDEHALHSTVHRPWGHYRGIDRGERFQVKRIVVQPGERLSLQMH 403 Rhodospirillum rubrum...
P0C7J3 313 GLENVVVVETDDAVLVGHRDRIQEVKEVVSQIKSAGRSEATWHRKVYRPWGAYDSIDMGQRFQVKRITVKPGATLSLQMH 392 Xanthomonas campestri...
P07874 315 GLEDIVVVETKDAMMIAHKDRVQDVKHVVKDLDAQGRSETQNHCEVYRPWGSYDSVDMGGRFQVKHITVKPGARLSLQMH 394 Pseudomonas aeruginos...
O24884 312 GVENLAVIDTKDALLIAHKDKAKDLKALVNEVETNNQELLQTHTKVYRPWGSYEVLHESGCYKVKILEVKPNARLSLQKH 391 Helicobacter pylori
O29168 294 GLRDLIVIDTDDALLVARRGEAEKVREVYRLLAEKGDKAVEVHRTAHRPWGSYTVLEENKSYKIKRITVKPKKRLSLQRH 373 Archaeoglobus fulgidus
P26404 317 GVSNLVIVQTTDALLVANKDTVQDVKKIVDYLKRNDRNEYKQHQEVFRPWGKYNVIDSGKNYLVRCITVKPGEKFVAQMH 396 Salmonella enterica s...
Q6FFU2 318 GVDNLVVIETKDAILVADKSKVQDIKKIVESIKEQGRTEHFCHREVYRPWGKYDSIDHAERYQVKRITVKPGQKLSIQMH 397 Acinetobacter baylyi
P26340 406 HHRAEHWVVVAGTARVTINGEVKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFED 475 Salmonella enterica subsp. ente...
Q2RMK3 404 HHRAEHWIVVTGTALVTRGAETFLLHENESTYIRAGQTHRLENPGKVPLHLIEVQSGGYLGEDDIVRFED 473 Rhodospirillum rubrum ATCC 11170
P0C7J3 393 HHRAEHWIVVSGTAEVTRGEEVLLLTENQSTYIPLGVTHRLKNPGKLPLELIEVQSGSYLGEDDIVRFED 462 Xanthomonas campestris pv. camp...
P07874 395 HHRAEHWIVVSGTAQVTCDDKTFLLTENQSTYIPIASVHRLANPGKIPLEIIEVQSGSYLGEDDIERLED 464 Pseudomonas aeruginosa PAO1
O24884 392 FHRSEHWVVISGMASVELDHQLFELQANESTYIPKNTLHRLANYGKIPLIIIEVQVGEYVGEDDIVRIDD 461 Helicobacter pylori
O29168 374 YHRSEHWVVVKGTARIVVDGNEILLRSGESTFVPAGAIHRIENPGKIPLEIIEIQIGEYLEEDDIERFED 443 Archaeoglobus fulgidus
P26404 397 HHRAEHWIVLSGTARVTKGEQTYMVSENESTFIPPNTIHALENPGMTPLKLIEIQSGTYLGEDDIIRLEQ 466 Salmonella enterica subsp. ente...
Q6FFU2 398 HHRSEHWIVVNGTAKIHKGKESFLLTENQSTYIPLGEIHALENPGKVPLELIEVQSGSYLGEDDIVRFED 467 Acinetobacter baylyi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap