6ZDY,1GQM


Conserved Protein Domain Family
S_100

?
pfam01023: S_100 
Click on image for an interactive view with Cn3D
S-100/ICaBP type calcium binding domain
The S-100 domain is a subfamily of the EF-hand calcium binding proteins.
Statistics
?
PSSM-Id: 460028
Aligned: 161 rows
Threshold Bit Score: 28.1714
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6ZDY_A         11 MERSITTIIDTFHQYSRKEG-HPDTLSKKEFRQMVEAQLATFMKKE 55   house mouse
XP_003409498    4 LLRSVLCVIETFHKYAREDG-DGVTLTHRELKQLLQGEFGDILQPH 48  
XP_003259307    4 LLRNVLCVIETFHKYASEDS-NGATLTSRELKQLLQREFGDFFQPC 48  
XP_003432306    4 LLRDVLCIIKTFHKYAQEDG-NKATLTCTELKQLIQGEFGDILQPY 48  
XP_004002558    4 LLRDILCVIETFHKYAREDG-GAATLTCTELQQLIQSEFEDIFQPC 48  
Q9D3P1          4 LLRGVFCVVEIFHKYAIEDGgNQATLTRTELRQLLEGEIGDFLQPH 49   house mouse
XP_002715398    4 LLRGVLCVMETFHKYAREDK---ATLTHRELEQLLQGELADSIQPH 46  
ELK02870       64 LVENILAIIDRFHQYSKTDE-ETETLSKEELKELLEMEFRPILKNP 108 
XP_008513630    4 ILENIISIIDLFHQYSTRDK-ETETLSKKELKELLEIEFQSILKNP 48  
XP_023403320    4 LLENITAIIDLFQQYSSNDK-ENDTLSKKELEELLETEFQPILENP 48  
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap