Conserved Protein Domain Family
HCV_NS4b

?
pfam01001: HCV_NS4b 
Hepatitis C virus non-structural protein NS4b
No precise function has been assigned to NS4b. However, it is known that NS4b interacts with NS4a and NS3 to form a large replicase complex to direct the viral RNA replication.
Statistics
?
PSSM-Id: 110032
View PSSM: pfam01001
Aligned: 11 rows
Threshold Bit Score: 201.835
Threshold Setting Gi: 81919863
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q69422 1616 ASFIPLEAMVAAIDKLKSTITTTSPftletALEKLNTFLGPHAATILAIIEYCCGLVTLPDNPFASCVFAFIAGITTPLP 1695 Hepatitis GB virus B
O39928 1729 FKEKVLGLIGTAGQKAETLKPAATS-----MWSKAEQFWAKHMWNFVSGIQYLAGLSTLPGNPAVATLMSFTAAVTSPLT 1803 Hepatitis C virus (...
O92933 1734 FKEKVLGLLQRATQQQAVIEPIVAT-----NWQKLEAFWHKHMWNFVSGIQYLAGLSTLPGNPAVASLMAFTASVTSPLT 1808 Hepacivirus C
P27958 1728 FKQKALGLLQTASRHAEVITPAVQT-----NWQKLEVFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLT 1802 Hepatitis C virus (...
O39927 1732 FRQKVLGLLQASAKQAEELKPAVHS-----AWPRVEDFWRKHMWNFVSGIQYLAGLSTLPGNPAVASLMSFTASLTSPLR 1806 Hepatitis C virus (...
O09803 1713 QAKTAEAYTATAKWLAGCYTGTRAVptvsiVDKLFAGGWAAVVGHCHSVIAAAVAAYGASRSPPLAAAASYLMGLGVGGN 1792 GB virus C
O56074 1723 RSFCANNYCPPGGG-ATSASAFFAS-----LDTKFAQAWDAIFTNGRSLLVGLVAGYGARRNPPLGVAAAFLMGMSAGHQ 1796 Pegivirus A
Q96898 1700 QAWAANNFVPPP---ASHSTSLLQS-----LDAAFTSAWDSVFTHGRSLLVGFTAAYGARRNPPLGVGASFLLGMSSSHL 1771 Pegivirus A
O56073 1710 QAWSSGMFVPPPAASAEHMPSIIQS-----LDTAFTRAWDTVFTHGRSLLVGFTAAYGAKRNPPLGVGASFLLGMSAGHS 1784 Pegivirus A
O41892 1702 KAWTAGVLVPPAPALADNAPGLLAT-----LDTMFTQTWEAIFTNGRSLLVGXTAAYGAKRNPPLGVAASFLLGMSAGRA 1776 Pegivirus A
P26661 1732 LKSKIQGLLQQATRQAQDIQPAIQS-----SWPKLEQFWAKHMWNFISGIQYLAGLSTLPGNPAVASMMAFSAALTSPLP 1806 Hepatitis C virus i...
Q69422 1696 HKIKMFLSLFGGAIASKLTDARGALAFMMAGAAGTALGTWTSVGFVFDMLGGYAAASSTACLTFKCLMGEWPTMDQLAGL 1775 Hepatitis GB virus B
O39928 1804 THQTLLFNILGGWVASQIAPPTAATAFVVSGMAGAAVGNIGLGRVLIDILAGYGTGVAGALVAFKIMCGERPTAEELVNL 1883 Hepatitis C virus (...
O92933 1809 TNQTMFFNILGGWVATHLAGPQSSSAFVVSGLAGAAIGGIGLGRVLLDILAGYGAGVSGALVAFKIMGGELPTAEDMVNL 1888 Hepacivirus C
P27958 1803 TGQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAALDSVGLGKVLVDILAGYGAGVAGALVAFKIMSGEVPSTEDLVNL 1882 Hepatitis C virus (...
O39927 1807 TSQTLLLNILGGWIAAQVAPPPASTAFVVSGLAGAAVGSIRLGRVLVDVLAGYGAGVSGALVAFKIMSGECPSTEDMVNL 1886 Hepatitis C virus (...
O09803 1793 AQTRLASALLLGAAGTALGTPVVGLTMAGAFMGGASVSPSLVT-ILLGAVGGWEGVVNAASLVFDFMAGKLS-SEDLWYA 1870 GB virus C
O56074 1797 VHVRLAAALLLGVGGTMLGTPSVGLAMSGAYFAGGSITSSWLS-AIVAVLGGWEGAXNAASLTFDFLTGRAE-LKDMWFL 1874 Pegivirus A
Q96898 1772 THVRLAAALLLGVGGTVLGTPATGLAMAGAYFAGGSVTANWLS-IIVALIGGWEGAVNAASLTFDLLAGKLQ-ASDAWCL 1849 Pegivirus A
O56073 1785 VHVRLAAALLLGVGGTMLGQASTGLAMAGAYFAGGSITSSWLS-VIVALLGGWEGAVNAASLTFDLLSGRAE-AKDAWCI 1862 Pegivirus A
O41892 1777 VHVRLAAALLLGVGGTMLGQASTGLAMAGAYFAGGSITSSWLS-IIITLLGGWEGAVNAASLTFDLLSGKAE-AKDAWCI 1854 Pegivirus A
P26661 1807 TSTTILLNIMGGWLASQIAPPAGATGFVVSGLVGAAVGSIGLGKILVDVLAGYGAGISGALVAFKIMSGEKPTVEDVVNL 1886 Hepatitis C virus i...
Q69422 1776 VYSAFNPAAGVVGVLSACAMFALTT--AGPDHWPNRLLT 1812 Hepatitis GB virus B
O39928 1884 LPSILCPGALVVGVICAAVLRRHIGpgEGAVQWMNRLIA 1922 Hepatitis C virus (isolate EUH1480)
O92933 1889 LPAILSPGALVVGVICAAILRRHVGpgEGAVQWMNRLIA 1927 Hepacivirus C
P27958 1883 LPAILSPGALAVGVVFASILRRRVGpgEGAVQWMNRLIA 1921 Hepatitis C virus (isolate H)
O39927 1887 LPALLSPGVALVGVVCAAILRRHVGpaEGANQWMNRLIA 1925 Hepatitis C virus (isolate EUHK2)
O09803 1871 IPVLTSPGAGLAGIALGLVLYSANN--SGTTTWLNRLLT 1907 GB virus C
O56074 1875 VSCXASPGASVAGVALGLLLWSMKK--GVGEDWVNRILT 1911 Pegivirus A
Q96898 1850 VSCLASPGASVAGVALGLLLWSVKK--GVGQDWVNRLLT 1886 Pegivirus A
O56073 1863 ISCLASPGASVAGAALGVLLWSMKK--GVGQDWVNRLLT 1899 Pegivirus A
O41892 1855 ISCLASPGASVAGVALGVLLWSVKK--GVGHDWVNRLLT 1891 Pegivirus A
P26661 1887 LPAILSPGALVVGVICAAILRRHVGqgEGAVQWMNRLIA 1925 Hepatitis C virus isolate HC-J8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap