Conserved Protein Domain Family
Rota_NS53

?
pfam00981: Rota_NS53 
Rotavirus RNA-binding Protein 53 (NS53)
This protein is also known as NSP1. NS53 is encoded by gene 5. It is made in low levels in the infected cells and is a component of early replication. The protein is known to accumulate on the cytoskeleton of the infected cell. NS53 is an RNA binding protein that contains a characteristic cysteine rich region.
Statistics
?
PSSM-Id: 144538
View PSSM: pfam00981
Aligned: 14 rows
Threshold Bit Score: 753.014
Threshold Setting Gi: 139495
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P89055     1 MATFKDACYHYRKLNKLNGLVLKLGANDAWRPAPIAKYKGWCLDCCQHTDLTYCRGCALFHVCQWCSQYNRCFLDEEPHL 80  Rotavirus sp.
O40627     1 MATFKDACYHYKRINKLNNNSLKLGVNDTWRPSPPTKYKGWCLDCCQHTDLTYCSGCTMYHVCQWCSQYGRCFLDNEPHL 80  Rotavirus A K8/G1
Q53AT6     1 MATFKDACYYYKRINKLNNAVLKLGVNDAWRPSPPTKCKGWCLDCCQHTDLTYCRGCSMYHVCQWCSQYGRCFLDNEPHL 80  Human rotavirus A
Q66773     1 MATFKDACYYYKRLNKLNHAVLKLGVNDAWRPSPPTKYKGWCLDCCQYTDLTYCRGCSIYHVCQWCNQYGRCFLDDEPHL 80  Equine rotavirus
ABA34226   8 MATFKDACYQYKKLNKLNNAVLKLGANDVWRPSTLTKRKGWCLDCCQHTDLTYCQGCLIYHVCEWCSQYSRCFLDNDPHL 87  Rotavirus A
P12475     1 MATFKDACYHYKRLNKLNSLVLKLGANDEWRPAPMTKYKGWCLDCCQYTNLTYCRGCALYHVCQWCSQYNRCFLDEEPHL 80  Bovine rotavirus st...
Q76II2     1 MATFKDACFFYKKLNRLNNQVLKLGANSVWRPAPLSKYKGWCLDCCQHTDLTYCKGCSLYHVCQWCSQYARCFLDNQPHL 80  Rotavirus G12
Q83444     1 MAAFKDACFHYRRITKLNRELLRIGANSSWTPAPPSNIRGWCLECCQLTNLTYCYGCSLHHVCQWCVQYGRCFLDDEPHL 80  Rotavirus A mouse/B...
P15687     1 MATFKDACFHYRRLTALNRRLCNIGANSICMPVPDEKIKGWCLECCQIADLTHCYGCSLPHVCKWCVQNRRCFLDNEPHL 80  Simian rotavirus A/...
Q9YKL8     1 MATFKDACFHYRKITKLNRELLRIGANSVWIPVSSNKIKGWCIECCQLTELTFCHGCSLAHVCQWCIQNKRCFLDNEPHL 80  Canine rotavirus K9
P89055    81 LRMRTFRNQISRKDIEGLINMYNTLFPINERIVDKFISNVKQRRCRNEFLIEWYNHLLLPITLQALMVELE-GDVYYIFG 159 Rotavirus sp.
O40627    81 LRMRTFKNEVTKDDLKNLIDMYETLFPMNHKIVCRFINTARQHKCRNECMTQWYNHLLMPITLQSLSIELD-GDVYYVFG 159 Rotavirus A K8/G1
Q53AT6    81 LRMRTFKNDVTKDDLMNLIDMYNTLFPMNQKIVSKFINSTRQHKCRNEYVIQWYNHLLMPITLQSLSAELD-GDVYYIFG 159 Human rotavirus A
Q66773    81 LRMRTFKNNITKEDLANLIDMYNVLFPVNQKIVNKFINNTKQHKCRNELVPQWYNHLLIPITLQSLSIELD-GDVYYIFG 159 Equine rotavirus
ABA34226  88 LRMRTFRNEITKSDLENLINMYDTLFPINQKIVNKFANTIKQHKCRNEYLIQWYNHFLMPITLQSLSIELD-GDIYYIFG 166 Rotavirus A
P12475    81 LRMRTFKDVVTKEDIEGLLTMYETLFPINEKLVNKFINSVKQRKCRNEYLLEWYNHLLMPITLQALTINLE-DNVYYIFG 159 Bovine rotavirus st...
Q76II2    81 LRMRTLKEPITKEDICNLVSMYSILFPINDKVVRKFSNNVRQHKCRNEYEFEWYNQLLFPITLQALTIKID-DSVYHIFG 159 Rotavirus G12
Q83444    81 LRLRTVKSPITTEKLASIVKMYQLLFPINHSIVKKFVKSTKQHKCRNDFELSWYNQLVLPITLTAAAVHCD-DCIYYIFG 159 Rotavirus A mouse/B...
P15687    81 LKLRTVKHPITKDKLQCIIDLYNIIFPINDKVIRKFERMIKQRKCRNQYKIEWYNHLLLPITLNAAAFKFDeNNLYYVFG 160 Simian rotavirus A/...
Q9YKL8    81 LKLRTFESPITKEKLQCIIDLYNLLFPINPGIINRFKKIVNQRKCRNEFEQSWYNQLLFPITLNAAVFKFH-SREVYVFG 159 Canine rotavirus K9
P89055   160 YFDHMEKENQTPFQFVNMINNYDKLLLDDKNFDRMTNLPVILQQEYAFRYFSKSRFISKTKKSVNRHDFANNLME-EMDN 238 Rotavirus sp.
O40627   160 YYDNMNNINQTPFSFINLVDIYDKLLLDDVNFTRMSFLPASLQQEYALRYFSKSRFINEQRKCVNDSHFSINVLE-NLHN 238 Rotavirus A K8/G1
Q53AT6   160 YYDHMNNINQTPFSFVNQVEYFNKLLLDDISFNKMSFLPVVFQQEYALRYFSKSRFITEERKGVNGFHSSVNKPE-NLDH 238 Human rotavirus A
Q66773   160 YYDDMKNANQTPFSFVNLIDMYDRLLLDDVNFNRMSFLPLVLQQEYALRYFSKSRFISEEKRQINHSHFSINILE-NLHN 238 Equine rotavirus
ABA34226 167 YYDDMHKINQTPFSFTNLISKYDVLLLDSINFDRMAFLPLTLQQEYALRYFSKSRFITERRKCIELSHFSDNILN-DLHN 245 Rotavirus A
P12475   160 YYDCMEHENQTPFQFINLLEKYDKLLLDDRNFHRMSHLPVILQQEYALRYFSKSRFLSKGKKRLSRSDFSDNLME-DRHS 238 Bovine rotavirus st...
Q76II2   160 YYDNMTKVNQTPFSFTNLINRYDKLLLDSINFDRMANLPGALQHQYALRYFSKSRFISHGIKDLCKSHFTEETLE-NKEI 238 Rotavirus G12
Q83444   160 HYEGKANQSNLPYRFVNCVDEYDRLLLDDVNFDRMAFLPGRLQKYYAKRYFIASRIPSAQPAKLTYSDFSVKTLI-NSGA 238 Rotavirus A mouse/B...
P15687   161 LYEKSVSDIYAPYRIVNFINEFDKLLLDDINFTRMSNLPIELRTI-MQEYFQLSRLPSSKLKQIYFSDFTKETVIfNTYT 239 Simian rotavirus A/...
Q9YKL8   160 LYEGSSSCINLPYRIVNCIDLYDRLLLDQINFERMSSLPASLQSVYANKYFKLSRLPSMKLKQIYYSDFSKQNLI--NKC 237 Canine rotavirus K9
P89055   239 PISLMQVMRNCVNey--mDDKNWNEKCT----LIVDMKSYMELMKSSYTEHYSVSQRCKLFTIYKLNIISKLIKPNYIFS 312 Rotavirus sp.
O40627   239 PSFKIQITRNCSE-----LSFDWNEACK----LVKNVSAYFDMLKTSHIEFYSVSTRCRIFTQCKLKMASKLIKPNYITS 309 Rotavirus A K8/G1
Q53AT6   239 PNFKVQISRNGGE-----VSSKWNEMCK----LVKDVNAYFGVLRTSHIEFYSISTRCRLFTLRKLRMVSKLIRPNYVTS 309 Human rotavirus A
Q66773   239 PNFKIQITRNCSA-----MLGEWNEACK----LVKDVGTYFEILKTSHVEFYDVSPRCRMFTQHKLKAVSKVIKPNYATS 309 Equine rotavirus
ABA34226 246 PNFTLQVIRNCSN-----MSVEWNNTCN----LIRNISNYFDILKSSHTESYNVSPRCRVFTQYKLKIASKLIKPNYVAS 316 Rotavirus A
P12475   239 PTSLMQVVRNCISih--iNDCEWNKACT----LIVDARNYISIMNSSYTEHYSVSQRCKLFTKYKFGIVSRLVKPNYIFS 312 Bovine rotavirus st...
Q76II2   239 PTSPYELTRNCTVnltsyGVMRWNDECK----KLVNANDYISEMNTSYTEHYTVSQQNLIFVEHKLNLLSKRIQPNYVAS 314 Rotavirus G12
Q83444   239 YARRRIIYRSVTN-------FHWQSHEDplndLLLDKDKILAALMTNERRPFLTHNLNFTSLLHELSELVHHAKPCYLHS 311 Rotavirus A mouse/B...
P15687   240 KTPGRSIYRNVTE-------FNWRDELElysdLKNDKNKLIAAMMTSKYTRFYAHDNNFGRLKMTIFELGHHCQPNYVAS 312 Simian rotavirus A/...
Q9YKL8   238 KIKSRIVLRNLTE-------FTWDSQISlhydVINNREKILTALSTSSLKRFETHDLNLGRIKADIFELGHHCKPNFISS 310 Canine rotavirus K9
P89055   313 NHGAHALDVHNCKWCQMNNHYKIWDDFRLKKVYNNTMCFIRALMKSNKNVGHRSSQEVVYEYMSNIFIVWKNEKWNKSMQ 392 Rotavirus sp.
O40627   310 NHKTLATEVHNCKWCSVNNSYTVWNDFRIKKIYDNIFNFLRALVKSNVNIGHCSSQEKIYEYVKDVLNVCDDERWKTSIM 389 Rotavirus A K8/G1
Q53AT6   310 NHRATATEVHNCKWCSINNSYTVWNDFRIKKVYDNIFSFMRALVKSNVNIGHCSSQEKIYEYIKNILDVCNDDKWNSSVV 389 Human rotavirus A
Q66773   310 NHRTLATEVRNCRWCSVNTNFIVWNDFRLRNICDNVLNFIRALVKSNTR-RHCSSQEQIHNYIRDVFDVCDENKWNTSVA 388 Equine rotavirus
ABA34226 317 NHNSLATEVHNCKWCSINNNSIVWTDFRIKNVYNDIFNFIRALVKSNLYVGHCSSEEKIYESIKDILNVCKENEWNMLVT 396 Rotavirus A
P12475   313 SHESCALNVHNCKWCQINNHYKVWEDFRLRKIYNNVMDFIRALMKSNGNVGHCSSQESVYKYIPDLFLICKTEKWNEAVE 392 Bovine rotavirus st...
Q76II2   315 NHSLRASKMRKCKWCALQPS-TFWDDFRLSDIYDLIMEFIRVLVKSNVNVGHCSSNEWIYPHMQNIFNPCRTQSYNFAIN 393 Rotavirus G12
Q83444   312 FHVQPASKVH-CHSCSVAFDFHTV-DWRIRRIYDDVMYFLRACCRSNVSSGSCSSLDPMDAVVKAALLEMFTESFKHHAH 389 Rotavirus A mouse/B...
P15687   313 NHPGNASDIQYCKWCNIKYFLSKI-DWRIRDMYNLLMEFIKDCYKSNVNVGHCSSVENIYPLIKRLIWSLFTNHMDQTIE 391 Simian rotavirus A/...
Q9YKL8   311 NHWQPASNVSQCRWCNVKYVFRNM-DWKMESMYNELLSFIQACYKSNVNVGNCSSIENAYPLVKDMIWHSITKYIDQTIE 389 Canine rotavirus K9
P89055   393 MIFDYLEPVEISGIEYILLDHELSWEIRGIVMQIMnGE-IPRILTFNDVKKIISAIIYDWFDVRYMREMPLIISTTNELR 471 Rotavirus sp.
O40627   390 EIFNCLEPVELDDVKYVLFNHEINWDVINVLVHSI-GK-VPQILTLENVITIMQSIIYEWFDIRYMRNTPMVTFTIDKLR 467 Rotavirus A K8/G1
Q53AT6   390 EMFDCLEPVELNATKYVLFNHEVNWDVINVLVQNI-GK-VPQVLTLNDIVVILQSIIYDWFDIRYMRHTPMTTFTIDKLR 467 Human rotavirus A
Q66773   389 SIFDCLEPVELDSVHYVLLNHEVNWDVANVLIQNI-GK-IPQILTLNDVITALHSMIYDWFDIRYMRNTPTTTFTVDKLR 466 Equine rotavirus
ABA34226 397 EIFNQLDPIKLNEDSYVLLNYEINWNVMNVLINSI-GK-VPKILTLSDVISILRIIIYDWFDIRFMRNTPMTTFTVNKLK 474 Rotavirus A
P12475   393 MLFNYLEPVDINGTEYVLLDYEVNWEVRGLVMQNMdGK-VPRILNMNDTKKILSAMIFDWFDTRYMRETPMTTSTTNQLR 471 Bovine rotavirus st...
Q76II2   394 KLFEYLESVEVDGTEYVMFDNNLTIELYDIIRSVMqCR-VPSILSKFDVAAIIKAIISKWFNIDRMRKVPLTLMQTSTLR 472 Rotavirus G12
Q83444   390 LLFHCFDPVQIDDVSYILFNYPVNYDIYDFIIRTLaTErLPFTLSYKQFTTILFALVERWYDLSQIERLPLSIAPTNRLI 469 Rotavirus A mouse/B...
P15687   392 EVFNHMSPVSVEGTNVIMLILGLNISLYNEIKRTLnVDsIPMVLNLNEFSSIVKSISSKWYNVDELDKLPMSIKSTEELI 471 Simian rotavirus A/...
Q9YKL8   390 KLFNVMNPVEVDGQQVISFHWQIDVALYIHIKMILkTEtLPFALTLYQFGSIIKGIVNQWYDVTELDYLPLCTEQTDKLV 469 Canine rotavirus K9
P89055   472 KMNKRNDLMdEYSYELSDTE 491 Rotavirus sp.
O40627   468 RLYTGLKTV-EYDSGISDIE 486 Rotavirus A K8/G1
Q53AT6   468 RLCVKKNTV-EYDSGISDVE 486 Human rotavirus A
Q66773   467 QLCARRKIA-DYDSGVSDVE 485 Equine rotavirus
ABA34226 475 QLYEKDRTV-EYDSDISDVE 493 Rotavirus A
P12475   472 TLNKRNELIdEYDLELSDVE 491 Bovine rotavirus strain RF
Q76II2   473 NLNSSDDLIdEYALMTSDDE 492 Rotavirus G12
Q83444   470 ELQERGNLAeEFDLLLSSSD 489 Rotavirus A mouse/Brazil/EHP/1981 G16Px[20]
P15687   472 EMKNSGTLTeEFELLISNSE 491 Simian rotavirus A/SA11-both
Q9YKL8   470 KLEEEGKISeEYELLISDSE 489 Canine rotavirus K9
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap