Conserved Protein Domain Family
Reovirus_cap

?
pfam00979: Reovirus_cap 
Reovirus outer capsid protein, Sigma 3
Sigma 3 is the major outer capsid protein of reovirus. Sigma 3 is encoded by genome segment 4. Sigma 3 binds to double stranded RNA and associates with polypeptide u1 and its cleavage product u1C to form the outer shell of the virion. The Sigma 3 protein possesses a zinc-finger motif and an RNA-binding domain in the N and C termini respectively. This protein is also thought to play a role in pathogenesis.
Statistics
?
PSSM-Id: 144537
View PSSM: pfam00979
Aligned: 5 rows
Threshold Bit Score: 517.506
Threshold Setting Gi: 75568901
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6SZ69         1 MEVRVPNFHSFVEGITSSYIRAPACWNAKTMWNIETFHLPDVIKVGNAYCCSQCCGVLYYGAPPSDGNYFPHHKCHQQQY 80  Avian orthoreov...
Q9DKH5         1 MEVRVPNFHSFVEGITSSYLKTPACWNARTAWDTVTFHVPDVIRVGNAYCCSQCCGVLYYGTLPADGNYFPHHKCHQQQY 80  Avian orthoreov...
Q91E46         1 MEVRVPNFHSFVEGITASYIRTPACWDSRSAWDSDIFYEPDVIKVGGAYCCTQCCGVLYYGAPPTDGICFPHHKCHQQLS 80  Muscovy duck re...
Q86298         1 MEVCLPNGHQVVDLINNAFEGRVSIYSAQEGWDKTISAQPDMMVCGGAVVCMHCLGVV--GSLQRKLKHLPHHRCNQQIR 78  Reovirus sp.
YP_007507324   1 MEVRTPNFHSFVESAYSSYLTRPDTWNPSTLWETGQFVTPDVIRLGNAYCCAQCCGVLYYGYRPINLYPFPHHRCHQLHR 80  Melaka orthoreo...
Q6SZ69        81 RSDTPLLRYVRIGRTTEHLLD---QYAVTLQTIADYYDEASHRVADEPEEDTIAALDIVTRTESIRSDQAVDADFWTYPL 157 Avian orthoreov...
Q9DKH5        81 RTDTPLLRYVRIGRTTEHLLD---QYAVALESIADHYDEISQRMVDEPENDEVAPLDIVTRTESIRSDKAVDPEFWTYPL 157 Avian orthoreov...
Q91E46        81 RVDNPLLRFVKIGRTTEHLLD---QYAVILSGIADHYEQAARSRPSMCGGDALMSLDIIMRTESLRTDRPVDPDFWTAPL 157 Muscovy duck re...
Q86298        79 QQDYVDVQFAD--RVTAHWKRgmlSFVAQMHAMMNDVSPEALERVRTEGGSLVELNWLQVGPDSMFRSIHSS---WTDPL 153 Reovirus sp.
YP_007507324  81 RETSPLLKVVRVGRTTDMVRE---HYAVWLQSLVDHLSDEKNIQDKEPMSSRVAS-------EVLRNDVAISGDFWRGTL 150 Melaka orthoreo...
Q6SZ69       158 ERRSD-DSRRDIA-ASIWTMIDASARSFTLPDCLVSPSLHSRHIFDQM--LTTTSIYDVAASGKTARFSPMVAALPQRAA 233 Avian orthoreov...
Q9DKH5       158 ERRSD-DSRRDIA-SACWRMIDASSRSLTLPNCLVSPSLHSRSVFGQM--QTTTTIYDVAASGKAVKFSPMVATLSQRDT 233 Avian orthoreov...
Q91E46       158 ERREP-DARSDIA-TAGWRMIDASSQSQTVPDCVVSNLLHTRHVFSQM--LTTTTAYDVAVTGKPAKFSPLVAVMPTRDS 233 Muscovy duck re...
Q86298       154 QVVDDlDTKLDQYwTALNLMIDSSD---LVPNFMMRDPSHVFNGVKLEgdARQTQFYRTFDSRSSLEWGVMVYDYSELEH 230 Reovirus sp.
YP_007507324 151 DLSPH-DSARSIH-DSMDKLSEVAGTHGLLPDCLLNVATHDHTALKMT--APVLNIYDQLDNARRSVLSATVTQMPKETA 226 Melaka orthoreo...
Q6SZ69       234 GPITLSDADPLDGVATFWS--PQF-------ALSPMIGGVG-ITGQYARESYHhVGHPVIGSGKKVSHYRNIFMDAWRGW 303 Avian orthoreov...
Q9DKH5       234 GPVMLADADPAEGVYSFWT--SHF-------ALSPLIGGVG-ITGQYARESYHqVGHPVIGSGKKASHYRNLFMESWRGW 303 Avian orthoreov...
Q91E46       234 GIISLTRDNWDHDVEDVWL--NGF-------AFSPIIGGVG-ISGQFERGACHnYGHPMIGSGKKVSHYRNLFMEVCRGW 303 Muscovy duck re...
Q86298       231 DP--LKGRAYRKELVTPARdfGHFglshysrATTPILGKMPaVFSGMLTGNCK--MYPFIKGTAKLKIVRKLVDAVNHAW 306 Reovirus sp.
YP_007507324 227 DAHKLQGHVTKEVAAAALLkpEHV-------IVTPIMAGLP-VLARSHQPSLR-VGMPLVESTQKASLYRSLPHQLAHGY 297 Melaka orthoreo...
Q6SZ69       304 SKSSFTCAAGLEPAE-CESRLRGHARTMLGRS----LPGVCDYGPEAQSRTAPSSLQ--KATKLTVVECG 366 Avian orthoreovirus
Q9DKH5       304 SKSAFACATGMEPAE-WESRLRGHARTMLGRS----LPHVCDDDVAQQSGAVLTSLQ--KTNKFTVVECG 366 Avian orthoreovirus strai...
Q91E46       304 SKSSFTCAVGLEPAE-CELRLRGQARTMLGRA----LPDVCDFDETTHTGQSSAPLR--RSSKVSFIECG 366 Muscovy duck reovirus
Q86298       307 GVEKIRYALGPGGMTgWYNRTMQQAPIVLTPAaltmFPDATKFGDLNYPVMIGDPMI-----------LG 365 Reovirus sp.
YP_007507324 298 HSDTFRTMFGLSANE-AESRLIGHHRTMLC-T----LPAI-ETSPTAVARATTSPLSivSSDKVTMHECS 360 Melaka orthoreovirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap