1H5O


Conserved Protein Domain Family
Myotoxins

?
pfam00819: Myotoxins 
Click on image for an interactive view with Cn3D
Myotoxin, crotamine
Crotamine is a family of cationic peptides expressed by the venom gland of, for example, Crotalus durissus terrificus. It acts as a cell-penetrating peptide (CPP) and as a potent voltage-gated potassium channel (Kv) inhibitor.
Statistics
?
PSSM-Id: 109859
View PSSM: pfam00819
Aligned: 3 rows
Threshold Bit Score: 65.4398
Threshold Setting Gi: 159162380
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1H5O_A  1 YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG 42 
P12028  1 YKRCHKKEGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSV 42  midget faded rattlesnake
P24331 23 YKRCHIKGGHCFPKEKICIPPSSDFGKMDCPWRRKCCKKGSG 64  tropical rattlesnake
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap