Conserved Protein Domain Family
Syntaxin

?
pfam00804: Syntaxin 
Syntaxin
Syntaxins are the prototype family of SNARE proteins. They usually consist of three main regions - a C-terminal transmembrane region, a central SNARE domain which is characteristic of and conserved in all syntaxins (pfam05739), and an N-terminal domain that is featured in this entry. This domain varies between syntaxin isoforms; in syntaxin 1A it is found as three alpha-helices with a left-handed twist. It may fold back on the SNARE domain to allow the molecule to adopt a 'closed' configuration that prevents formation of the core fusion complex - it thus has an auto-inhibitory role. The function of syntaxins is determined by their localization. They are involved in neuronal exocytosis, ER-Golgi transport and Golgi-endosome transport, for example. They also interact with other proteins as well as those involved in SNARE complexes. These include vesicle coat proteins, Rab GTPases, and tethering factors.
Statistics
?
PSSM-Id: 425876
Aligned: 68 rows
Threshold Bit Score: 169.276
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q84R43        44 GFFQETEAVEEEMAAIRDALARLNAANeeGKSLHQPDALRALRGRVNADIIAVLRRARDIRARLEAMDRANAAQRRLSag 123 Japanese rice
XP_011489942  49 EILHEASLIRKSIILLSLDVERLKNNN--ERYGTSVSRFSILKRDSDSIARKIQQQGDSVYKRIQALGDRANELEQTE-- 124 Japanese medaka
Q4S6Z1        45 NILAKAQSIRKEVSSLRLQVSGLSALT--ERFGTSVSRLTVIKRDFDSVARKVQGRGETLYGRLQGLRQESGQLQEKE-- 120 spotted green p...
Q4REJ3        43 GLHKEAQALRKEMQLLRADVRRLGKQN--ARFLTSVRRISSIKRDANALRRDIKERMDAIYARMETLKKQGKEQEEQP-- 118 spotted green p...
XP_004085546  47 RIYKEAQVMQKEMLMLKLDVKRLGKQN--ARFLTSVRRISSIKRDSNALGRDIKARGEAIYARLEKLGKQSRELEEEH-- 122 Japanese medaka
XP_007484739  43 SLYKDIQDIQTENHLLIVDVKRLGKQN--LRFLTSMRRLSSIKRDTNSIAKDIKTRGEAIHKKLQMMKTFCEVAELKH-- 118 gray short-tail...
XP_005615540  46 SLYRDIQDLQEENQQLMTDVKRLGKQN--TRFLTSIRRLSSIKHDTSSIAKDIKARSENIHRKLRALKARGEEAEEVH-- 121 dog
XP_017949350  41 SLYQDIQLIRTENHLMKVDVKRLGKQT--TRFLTSMRRLSSIKRDSNSIAKDIKTRAEGIHKKLQSLKNLSEDAENKS-- 116 tropical clawed...
XP_016854198  43 SLYKDIQGIRTNNHHLNEDVRRLGKQN--TRFLTSMRRFSSIKRDANSIAKDIKARGEDIHRRLQVLRDFSEDAETKY-- 118 green anole
XP_005998116  41 NLHKEVQLIQDKNQMLRVDIRRLGKQN--TRFLTSMRRLSSIKRDSNTIAKDIKSRGEDIYCRLQEIKTFSEEVEQKH-- 116 coelacanth
Q84R43       124 cREGTPLDRTRTALTAALRKKLKDLMLDFQALRQRIMSEYKDTVERRYYTLtGEVPEEEVIERIISEGr-SEELLCAAVA 202 Japanese rice
XP_011489942 125 -GGNRAVSRIARIQYDTLAFALRSAMENYNSAEEKQREICKTRIQRQASII-GKDISDEQLNDLVNKGgeGWEELCQSLQ 202 Japanese medaka
Q4S6Z1       121 -GPSSAASRIAKAQCDALVHDFNAVMGDYNRAEEMQKIICRGRIKRQASIL-GTEISDEQLDVVVSDGgeGWTALSHSLQ 198 spotted green p...
Q4REJ3       119 -QSSAAVARMVQVQCVSLAAAFHEVVCEYNEAEMSQRENCLSRIQRQANIM-GKELSTEEMEEMMETG--KVNVFADNVL 194 spotted green p...
XP_004085546 123 -GATSAVARMAGSQCVYLTNAFHEAMCEYNTAEMLQRENCKTRIQRQAEIM-GKEVSREQIEEMIETG--KCSLFSDNLL 198 Japanese medaka
XP_007484739 119 -GANSAMARISKAQYNVLTWTFQQAMHDYNQVEMNQRENCKIRIQRQLEIM-GKDVSRAQIEEMCEEG--KWDVFSENLL 194 gray short-tail...
XP_005615540 122 -GAHSAVARISRAQYNALTRTFQHAMQGYNQAEVKQRDNCKIRIQRQLEIM-GKDVSDDQIEDMIEQG--KWDVFSENLL 197 dog
XP_017949350 117 -GESSVMARVSKSQYMTLTLEFQEAMLEYNEAEMVQRENCKIRIQRQLEIM-GKDVSGNQIDDMIEQG--KWDVFSENLL 192 tropical clawed...
XP_016854198 119 -GSNSIISRVSKDHYVDLMHAFQEAMFEYNKIEMNQRENCKVRIQRQLEIM-GKDVSGNQIEDIIEQG--RWDVFSENLL 194 green anole
XP_005998116 117 -GPNSALARIAKAHHVVLTYAFQEAMVEYNEAEMNQRENCKIRIQRQLEIM-GKDISGNQIEDMIEQG--KWDVFSGNLL 192 coelacanth
Q84R43       203 EHGKGAVLATVHEIQDRHDAAREVERSLLELHQVFLDMAVVVESQG 248 Japanese rice
XP_011489942 203 PPGAQSCRTALNEIKTRHTELVNLEARLKDIHEMFLQMAVLVEEQG 248 Japanese medaka
Q4S6Z1       199 TVGGRTSRWAMNEIKGRHKELVELEARLREVHELFLQMAALVESQG 244 spotted green pufferfish
Q4REJ3       195 L-EGKTARSALSEIESRHKELLELEKRIREIQELFSQMALLVEEQG 239 spotted green pufferfish
XP_004085546 199 L-EGRSARSALTEIENRHKELLELEGRIRDIHELFFQMALLVEEQG 243 Japanese medaka
XP_007484739 195 S-DVKGARSALNEIESRHKELMKLESRIRDVYGLFLQMAVLVEEQG 239 gray short-tailed opossum
XP_005615540 198 A-DVKGARAALNEIESRHRELLRLESRIQEVRKLFVQMAVLVEEQA 242 dog
XP_017949350 193 S-DVKVARSALNEIETRHKELLKLESRIREVHDLFLQMAILVEEQA 237 tropical clawed frog
XP_016854198 195 S-DAKGARSALNEIETRHKELMKLESRIKEVHELFMQVALLVEEQA 239 green anole
XP_005998116 193 A-DVKGARSALNEIECRHKELLKLETRIREVHELFLQMALVVEQQA 237 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap