Conserved Protein Domain Family
Glycoprotein_G

?
pfam00802: Glycoprotein_G 
Pneumovirus attachment glycoprotein G
This family includes attachment proteins from respiratory synctial virus. Glycoprotein G has not been shown to have any neuraminidase or hemagglutinin activity. The amino terminus is thought to be cytoplasmic, and the carboxyl terminus extracellular. The extracellular region contains four completely conserved cysteine residues.
Statistics
?
PSSM-Id: 144411
View PSSM: pfam00802
Aligned: 4 rows
Threshold Bit Score: 186.042
Threshold Setting Gi: 123843098
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q38I81  10 ARTLEKTWDTLNHLIVISSCLYKLNLKSIAQIALSVLAMIISTSLIIAAIIFIISANHKVTLTTVTVQTIKNHTEKNITT 89  Human orthopneumovirus
Q82071  10 AKTLERTWDTLNHLLFISSCLYKLNLKSVAQITLSILAMIISTSLIIAAIIFIASANHKVTSTTTIIQDATNQIKNTTPT 89  Human orthopneumovirus
P22261  10 FKTLKRAWKASKYFIVGLSCLYKFNLKSLVQTALSTLAMITLTSLVITAIIYISVGNAKAKPTSKPTIQQTQQPQNHTSP 89  Bovine respiratory sy...
Q86695  10 FKTLKKAWKASKYFIVGLSCLYKLNLKSLVQMALSALAMITLVSLTITAIIYISTGNTKAKPMPTPTIQITQQFQNHTSL 89  Ovine respiratory syn...
Q38I81  90 YLTQVSPERVSPSKQPTTTPPIHTNSATISPNTKSETHHTTAQTKGRTT----TPTQNNKPSTKPHPKNPPKKPKDDYHF 165 Human orthopneumovirus
Q82071  90 YLTQNPQLGISPSNPSEITSLITTILDSTTPGVKSTLQSTTVGTKNTTT----TQAQPNKPTTKQRQNKPPSKPNNDFHF 165 Human orthopneumovirus
P22261  90 FFTEHNYKSTHTSIQSTTLS--QLLNIDTTRGI--TYGHSTNETQNRKIkgqsTLPATRKPPINPSGSIPPENHQDHNNF 165 Bovine respiratory sy...
Q86695  90 PPTEHNHNSTHSPTQGTTSP--HTFAVDVTEGT--RYYHLTLKTQGGKTkgppTPHATRKPPISSQKSNPSEIQQDYSDF 165 Ovine respiratory syn...
Q38I81 166 EVFNFVPCSICGNNQLCKSICKTIPSNKPKKKPTIKPTNKPPTKTTnKRDSKTLAKTLKKETTINPTKKPTPKTTERDTS 245 Human orthopneumovirus
Q82071 166 EVFNFVPCSICSNNPTCWAICKRIPNKKPGKRTTTKPTKKPTLKTT-KKDPKPQTTKSKEAPTTKPTEEPTINTTKTNIT 244 Human orthopneumovirus
P22261 166 QTLPYVPCSTCEGNLACLSLCHIETERAPSRAPTITLKKTPKPKTT-KKPTKT--------TIHHRTSPETKLQPKNNTA 236 Bovine respiratory sy...
Q86695 166 QILPYVPCNICEGDSACLSLCQDRSESILDKALTTTPKKTPKPMTT-KKPTKT--------STHHRTSLRNKLYIKTNMT 236 Ovine respiratory syn...
Q38I81 246 TpqfTVLDTTTSKHTERdtstsqsivldtttskhTIQQQSLHSTT 290 Human orthopneumovirus
Q82071 245 T---TPLTSNTTRNPEL-----------------TSQMETFHSTS 269 Human orthopneumovirus
P22261 237 TpqqGILSSTE------------------------------HHTN 251 Bovine respiratory syncytial virus (strain Copenhagen)
Q86695 237 TpphGLISTAK------------------------------HNKN 251 Ovine respiratory syncytial virus (strain WSU 83-1578)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap