6SEM,6SEK


Conserved Protein Domain Family
FMO-like

?
pfam00743: FMO-like 
Flavin-binding monooxygenase-like
This family includes FMO proteins, cyclohexanone mono-oxygenase and a number of different mono-oxygenases.
Statistics
?
PSSM-Id: 395602
View PSSM: pfam00743
Aligned: 7 rows
Threshold Bit Score: 992.36
Threshold Setting Gi: 6166183
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6SEM_A   2 AKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGLWRFKENVEDGRASIYQSVITNTSKEMSCFSDFPMPEHFPNF 81 
P49109   3 KKRIAVIGGGVSGLSSIKCCLEEGLEPVCFERSADIGGLWRFQENPEEGRASIYKSVIINTSKEMMCFSDYPIPDHYPNF 82  domestic guinea pig
P31512   2 AKKVAVIGAGVSGLSSIKCCVDEDLEPTCFERSDDIGGLWKFTESSKDGMTRVYKSLVTNVCKEMSCYSDFPFHEDYPNF 81  human
P31513   2 GKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFSNSSKEMMCFPDFPFPDDFPNF 81  human
Q01740   2 AKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVSNSCKEMSCYSDFPFPEDYPNY 81  human
P36366   2 AKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGLWRFKENVEDGRASIYKSVITNTSKEMSCFSDFPMPEDFPNF 81  domestic guinea pig
6SEK_A   3 KKRIAVIGAGASGLTSIKCCLEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVIINTSKEMMCFSDYPIPDHYPNF 82 
6SEM_A  82 LHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVKKCPDFSSSGQWEIVTESNGKEQSAVFDAVMVCSGHHILPHIPLQSFP 161
P49109  83 MHNSHVLEYFRMYAKEFGLLKYIQFKTTVCNVKKRPDFSTSGQWEVVTEHEGKTKVDVFDAVMVCTGHHTNAHLPLESFP 162 domestic guinea pig
P31512  82 MNHEKFWDYLQEFAEHFDLLKYIQFKTTVCSITKRPDFSETGQWDVVTETEGKQNRAVFDAVMVCTGHFLNPHLPLEAFP 161 human
P31513  82 MHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFP 161 human
Q01740  82 VPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFP 161 human
P36366  82 LHNSKLLEYFRLFAKKFDLLKYIQFQTTVLTVKKHPDFSSSGQWEVVTQSDGKEQSAVFDAVMVCSGHHILPHIPLKSFP 161 domestic guinea pig
6SEK_A  83 MHNSQVLEYFRMYAKEFDLLKYIQFKTTVCSVKKQPDFSTSGQWEVVTECEGKKEVDVFDGVMVCTGHHTNAHLPLESFP 162
6SEM_A 162 GIERFKGQYFHSRQYKHPEGFEGKRILVIGIGNSASDIAVELSKKAAQVFISTRHGSWVMSRISDDGYPWDMVFHTRFSS 241
P49109 163 GIEKFKGQYFHSRDYKNPEAFTGKRVVIIGIGNSGGDLAVEISHTAKQVFLSTRRGSWILNRVGKHGYPTDVLLSSRFTY 242 domestic guinea pig
P31512 162 GIHKFKGQILHSQEYKIPEGFQGKRVLVIGLGNTGGDIAVELSRTAAQVLLSTRTGTWVLGRSSDWGYPYNMMVTRRCCS 241 human
P31513 162 GLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFGT 241 human
Q01740 162 GINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQN 241 human
P36366 162 GIERFKGQYFHSRQYKHPAGFEGKRILVIGIGNSASDIASELSKNAAQVFISTRNGSWVMSRISEDGYPWDMVFHTRFKS 241 domestic guinea pig
6SEK_A 163 GIEKFKGQYFHSRDYKNPEGFTGKRVIIIGIGNSGGDLAVEISHTAKQVFLSTRRGAWILNRVGDHGYPFDVLFSSRFTY 242
6SEM_A 242 MLRNVLPRTVVKWMMEQQMNRWFNHENYGLEPQNKYLMKEPVLNDDLPSRLLYGAIKVKSRVKELTETSAIFEDGTVEED 321
P49109 243 FLSKILGQSLSNAYVEKQMNERFDHEMFGLKPKHRAMSQHPTVNDDLPNRIIAGMVKVKGNVKEFTETAAIFEDGSREDD 322 domestic guinea pig
P31512 242 FIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAK-FIVNDELPNCILCGAITMKTSVIEFTETSAVFEDGTVEEN 320 human
P31513 242 FLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVKPNVKEFTETSAIFEDGTIFEG 321 human
Q01740 242 MLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEP 321 human
P36366 242 MLRNILPRTVSKWMMEQQLNRWFNHANYSLEPKNKYLMKEPILNDDLPSRILYGAVKVKSRVTQLTETSALFEDGTVEED 321 domestic guinea pig
6SEK_A 243 FLSKICGQSLSNTFLEKKMNQRFDHEMFGLKPKHRALSQHPTVNDDLPNRIISGLVKVKGNVKEFTETAAIFEDGSREDD 322
6SEM_A 322 IDVIVFATGYTFSFPFLEDSlVKVENNMVSLYKYMFPPHLEKPTLACIGLIQPLGSIFPTVELQARWVTRVFKGLCTLPS 401
P49109 323 IDAVIFATGYSFDFPFLEDS-VKVVKNKVSLYKKVFPPNLERPTLAIIGLIQPLGAIMPISELQGRWAVQVFKGLKTLPS 401 domestic guinea pig
P31512 321 IDVVIFTTGYTFSFPFFEEPlKSLCTKKIFLYKQVFPLNLERATLAIIGLIGLKGSILSGTELQARWVTRVFKGLCKIPP 400 human
P31513 322 IDCVIFATGYSFAYPFLDESiIKSRNNEIILFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPS 401 human
Q01740 322 IDIIVFATGYTFAFPFLDESvVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPP 401 human
P36366 322 IDVIVFATGYTFSFPFLEESlVKIEHNMVSLYKYMFPPQLEKPTLTCMGLIQPLGSIFPTVELQARWATRVFKGLCHLPS 401 domestic guinea pig
6SEK_A 323 IDAVIFATGYSFAFPFLEDS-VKVVKNKVSLYKKVFPPNLEKPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKTLPS 401
6SEM_A 402 ESTMMADIIKRNEKRIDLFGESQSQILQTNYIDYLDELALEIGAKPDLLSLLLKDPKLAMKLYFGPCNSYQYRLVGPGQW 481
P49109 402 QSEMMAEITKAQEEIAKRYVDSQRHTIQGDYIQTMEEIAEFVGVKPNLLSLAFTDPKLALKLFFGPCTPIHYRLQGPGKW 481 domestic guinea pig
P31512 401 SQKLMMEATEK-EQLIKRGVFKDTSKDKFDYIAYMDDIAACIGTKPSIPLLFLKDPRLAWEVFFGPCTPYQYRLMGPGKW 479 human
P31513 402 MEDMMNDINEKMEKKRKWFG--KSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQW 479 human
Q01740 402 PSVMIEEINARKENKPSWFGLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGKW 481 human
P36366 402 EKTMMEDIIKRNEKRIDLFGESQSQIVQTNYVDYLDELALEIGAKPDLISFLLKDPELAVKLCFGPCNSYQYRLVGPGQW 481 domestic guinea pig
6SEK_A 402 QSEMMAEISKAQEEMAKRYVDSQRHTIQGDYIDTMEEIADLVGVRPNLLSLAFTDPKLALKLFFGPCTPVQYRLQGPGKW 481
6SEM_A 482 EGARNAIFTQKQRILKPLKTRALKASSNFPVSF-LLKILGLLAVVVAFFFQL 532
P49109 482 HGARKAILTTYDRIRKPLNTRETEKSNSMVSAV-TTGCFMLAVVFFAIIMAY 532 domestic guinea pig
P31512 480 DGARNAILTQWDRTLKPLKTRIVPDSSKPASMShYLKAWGAPVLLASLLLIC 531 human
P31513 480 PGARNAILTQWDRSLKPMQTRVVGRLQKPCFFFhWLKLFAIPILLIAVFLVL 531 human
Q01740 482 EGARNAIMTQWDRTFKVIKARVVQESPSPFESF--LKVFSFLALLVAIFLIF 531 human
P36366 482 EGARRAILTQKQRILKPLKTRSVKAAPNLSASF-LMKILALVAVFVAFFSQL 532 domestic guinea pig
6SEK_A 482 DGARKTILTTEDRIRKPLMTRVIEKSNSMTSTM-TMGRFMLAVVFFAIIMAY 532
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap