Conserved Protein Domain Family
X

?
pfam00739: X 
Trans-activation protein X
This protein is found in hepadnaviruses where it is indispensable for replication.
Statistics
?
PSSM-Id: 109783
View PSSM: pfam00739
Aligned: 5 rows
Threshold Bit Score: 195.946
Threshold Setting Gi: 139897
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q80IS4   1 MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSA--RR 78  Hepatitis B virus
Q806D2   1 MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVSTDHGAHLSLRGLPVCAFSCAGPCALRFTSA--RR 78  Hepatitis B virus
Q80JC8   1 MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSA--RR 78  Hepatitis B virus
P03167   1 MAARLCCQLDPARDVLLLRPFGSQSSGPPFPRPSAGSAASPASSLSASDESDLPLGRLPACFASASGPCCLVVTCAelRT 80  Woodchuck hepatitis v...
P03168   1 MAARLCCQLDSSRDVLLLRPLRGQPSGPSVSGTSAGSPSSAASAFSSGHQADIPVGRLPACFYSSAGPCCLGFTCAdlRT 80  Ground squirrel hepat...
Q80IS4  79 METTVNDHRNLSKVLHKRTLGLSAMSTTDL-EAYFKDCVFTEWEELGEEMRLMIFVLGGCRHKLV 142 Hepatitis B virus
Q806D2  79 METTVNAHRILSKDLRTMTLELSGLSTSDL-EAYFKDRVFTEWEELGEEIRLMIFVLGGCTHTLL 142 Hepatitis B virus
Q80JC8  79 METTVNAHQVLPKVLHKRTLGLSAMSTTDL-EAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLV 142 Hepatitis B virus
P03167  81 MDSTVN----FVSWHANRQLG---MPSKDLwTPYIRDQLLTKWEEGSIDPRLSIFVLGGCRHKCM 138 Woodchuck hepatitis virus 1
P03168  81 MDSTVN----FVPWHAKRQLG---MMQKDFwTAYIRDQLLTLWEEGIIDPRLKLFVLGGCRHKYM 138 Ground squirrel hepatitis virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap