3DL8,5CH4,3DIN,2YXR


Conserved Protein Domain Family
SecE

?
pfam00584: SecE 
Click on image for an interactive view with Cn3D
SecE/Sec61-gamma subunits of protein translocation complex
SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.
Statistics
?
PSSM-Id: 459858
Aligned: 695 rows
Threshold Bit Score: 26.6222
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3DL8_D               5 KEFLKGVRDELKRVVWPSRELVVKATISVIIFSLAIGVYLWILDLTFTKII-SFIL 59  Aquifex aeolicus
WGS:AATM:SJAG_00959 14 KTLYKEGSAFVKRCVKPNRKEFLSVSKAVAAGFILMGFIGYIIKLVH-IPInNVLV 68 
Q09827              13 KNFYKEGSHFIKRCVKPDRKEFLSISKAVATGFVLMGLIGYIIKLIH-IPInKVLV 67  Schizosaccharomyces pombe 972h-
XP_006676520        12 QQFVKESIQFVSRCTKPDRKEFVKVTQAVGVGFILMGFIGFFVKLIH-IPInNIIV 66 
XP_007793782        10 KDFIKDGSQFINRCTKPDQKEFIKVCQAVGVGFLIMGATGYLVKLIH-IPVnNILV 64 
EJW04490            12 TEHVKAAQMFMKKCVKPNLKEFSSLLKVEMLGIAGLGLVGFFIKIIH-IPInNLLV 66 
Q8SRW9              12 SEYLRSIRLFSKKCVRPSGKELSMSIKRHAIGIGFLGILGYAIKLIH-IPInNIIV 66  Encephalitozoon cuniculi GB-M1
ELA46330            18 KHFI-------SKCEFPTKDEYMLLLRQHVIGIGFLGVLGYIVR-FVHILInNVIV 65 
EIJ87834            46 KLFL-------KRSKKPSSGEYRQMLAAHTKGVLLLGFLGYII-TFIHIPInNILF 93 
ELA41024            27 KRFLKNIRKFIRESEKPSHDQFRHILRGHLVGVIALGLFAYCIK-VIHIPInNMIA 81 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap