4F48,4AFY


Conserved Protein Domain Family
EAL

?
pfam00563: EAL 
Click on image for an interactive view with Cn3D
EAL domain
This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues. The EAL domain is a good candidate for a diguanylate phosphodiesterase function. The domain contains many conserved acidic residues that could participate in metal binding and might form the phosphodiesterase active site.
Statistics
?
PSSM-Id: 425752
Aligned: 63 rows
Threshold Bit Score: 112.796
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4F48_A               12 VEQLREA---L--IGDGFLLHYQP-VLN-LQGEPleLYQAFLRL-ERNGE-MMSPNAFMAIAEEHDLITEIDRWVVARAI 82   Xanthom...
Q21G90              340 AAKIEKG---L--QGREFSTVFQSyYCDdDSNPL--YAEAFSRWrSTSLG-NVAPREFLPALSQNSMLDELTKQVLANVA 411  Sacchar...
BAF69323            490 LETRSKFdfdKgmKNKEFIVYYQP-IID-TKQGSvfGFEALVRWnLYHKDlLV-PSAFLSYIKSf-------ETLLKLHK 559  Nitrati...
Q1H053              434 RQELRKA---I--ENGEMALYFEP-RMD-MAGGTitGLEVLPRWlHPTKG-AIPAATFAPMAENMGLINDINTWVLEQSC 505  Methylo...
Q13KE1              103 ESRVRQG---L--SAGEFHLVFQG-AYR-AASGTlaRLEAQLRWkHPDYG-LLLPALFMTALGHPQLALDMALFVVDGVC 174  Parabur...
SDU_Lin:LFML04_0977 559 rleLVSS---V--RENRFIFHYQP-QVE-LRSGKvvGAEALLRWnHPAKG-LLEAGSFIKTLEDCDVILETEQWGLEEIL 630  Leptosp...
Q31RU9              324 DRDWQQA---I--AAGELTLALQP-QMG-LRNRQlrGFEVQLRWqHPQQG-TLLASQLMEHLEQSQHRETVGRWFLDQAG 395  Synecho...
Q21JH1              661 ENDLRNA---I--HNNELRLAYQP-IVD-FKTGKtvFFEAYVKWrRKKLI-APTVEGFTQRPEDTGALIPAGEWMLRTIV 732  Sacchar...
Q5ZZD8              290 MNELQRS---I--ENKDLKIYYQP-IVE-LANGQivGAESSARFeHPELG-LLSAEKFMPLIEGTSLIHNLTTLMLKEVI 361  Legione...
WP_011707890        506 EEMLARA---L--REGRIVPYFQP-VIR-LKDSRltGLEVMARWiTEEGV-LKDAFDFIPLAEQCGLIQELDYQILSHTC 577  Aeromonas
4F48_A               83 R-QLGE---Rqr-aGHKTHL--LVRIGP-NSFSDPQ---MIDTIReqlavYGVPGER-LWLQTPES----KVFTHLRNAQ 146  Xanthom...
Q21G90              412 QlQEQAlaaN----RPIGKF--SVNIST-AQLHDRI---FCENFLhwlsvNDLSSNT-ICLEISER----ESINAILACK 476  Sacchar...
BAF69323            560 FvIVQSmhdLqsfiSNGFHPyiSINIDS-NIFYHKKfieMIDEIF-----STFEHCDlVIFEIEEKglgeNR---SSNHD 630  Nitrati...
Q1H053              506 R-IIKDl------qGHLIHVpvYLPLTS-AQLHTPG---IQQHVAdtlnrFKLPSDA-LVLEVAEL----DFMQQPEHHT 569  Methylo...
Q13KE1              175 R-ELRGc--Laa-nLPLPPV--AIAMPAhVALHES----FAGEVArvadsYGVPPRL-FEIEVSDS----AEAAKLLTLR 239  Parabur...
SDU_Lin:LFML04_0977 631 R-QSDLwsrQ----GLNLHI--RMNISC-RSLLSGR---FPSDLKnafgrYPRLSPSlLELDISDT----KLFRDIRKVK 695  Leptosp...
Q31RU9              396 Q-LLSQwr-----nSAQFSGlfALSLLP-QQWKSPS---FIHDLRslletYQIPPEQ-LELDLPAQ----SLAESAAESW 460  Synecho...
Q21JH1              733 Q-QLTDw--Sl--mHEPTPI--SVNLSA-RQFETAS---LLERVInil-qsSPAAKNkICIEVKES----FLDSNTLHAS 796  Sacchar...
Q5ZZD8              362 K-QLAAw------hDAGHKIfvSANLSVnRGLPD-----LIEKLLn---dYEIAPQF-LKLEFTER----TCLAEQMVTS 421  Legione...
WP_011707890        578 Q-QLKEwlpLs--gQSKFKV--AINLSG-KHLVSHE---QIMKLVeiiesEGIAPGY-LIFEFNER----ELSRQDSDAL 643  Aeromonas
4F48_A              147 --QFLASVSAMGCKVGLEQFGSGLDSFQLLAHFQPAFLKLDRSIT--GDIASARESQEKIREITSRAQPTGILTVAEFVA 222  Xanthom...
Q21G90              477 --SNIHFLHQQGISFALDNFGTGNTAMTQLADLPIDYLKIDRAIT--QNIDTNKPMQALSSSVIKMAHKLGIKVVAEGIE 552  Sacchar...
BAF69323            631 ifEVCKK---HGIKILIDNFKGEYFTLTHFINFPFDFIKVDKSLIinAIQ--DIENFAILEGSYAVAEAFLKDVIALGVE 705  Nitrati...
Q1H053              570 --DLLKQLPAISLKISLENFGTRFSSLPYIQHLGLKILKLDHSFT--RELLSNPKARAIAGAIIELAHAQHLKVVAEHVS 645  Methylo...
Q13KE1              240 --TLTESLRDIGVSITLGNWGNGGSSMALLGGLDVDTVTIARELM--ATVPRDARAGTVMTALIDLLHALDVRVVVSGVD 315  Parabur...
SDU_Lin:LFML04_0977 696 --TIVDECRKTGVSLSIGNIGSEQGAFSYLQTLGIDRVTIPRNFV--HNLENSPRDMAIVASLITSARLLLVHAVGEGIE 771  Leptosp...
Q31RU9              461 --DWVYAVRDLGIGIGLADFGSRSIGLYDLRNLPLTTLKLERRFV--RGLPDDANDRAIVRGVVAMSQALKVRIVARGVD 536  Synecho...
Q21JH1              797 ----MDRLKSIGCDVLVEGFANGLADCASLNALPIKIIKLHPNIT--NTIDQGDAYQAFAKASIDLLHSFGFKVVAQGIQ 870  Sacchar...
Q5ZZD8              422 --EVFERLSTMGIKLCIDDFCSENSSFIYLTDFPIENIKVEKSFV--LKIAKDAKKAKIVEAIVKLAQTLGWEPLADGIA 497  Legione...
WP_011707890        644 --TSLHELRAKGIQISLDDFGTGFSSLNALFHFPVDYIKVDDSFT--HRMLQSPKDLALIRAMRDICQDLDFTLVVEGIE 719  Aeromonas
4F48_A              223 DAQSMSSFFTAGVDYVQGDFVAPT 246  Xanthomonas campestris pv. campestris
Q21G90              553 TQEEFYVLRAFDCDFYQGFYFGQP 576  Saccharophagus degradans 2-40
BAF69323            706 TSDIIPTLNEIGIHYIQGYEIAKP 729  Nitratiruptor sp. SB155-2
Q1H053              646 NEAERNTLLSLECNEIQGYFCANP 669  Methylobacillus flagellatus KT
Q13KE1              316 TEEQLQWLRRWPEVLVQGALVSRP 339  Paraburkholderia xenovorans LB400
SDU_Lin:LFML04_0977 772 TEQEGLHLLQWGCQIGQGNAISPP 795  Leptospirillum ferriphilum ML-04
Q31RU9              537 TVDQAKFLARAECDAMQGLAYSAP 560  Synechococcus elongatus PCC 7942
Q21JH1              871 TRRQLKTLIALGCDFGQGEYFSEP 894  Saccharophagus degradans 2-40
Q5ZZD8              498 DQNALEKLRDLGCLYGQGLYFSRA 521  Legionella pneumophila subsp. pneumophila str. Philadelphia 1
WP_011707890        720 NQQQLQKLIDLGCLMGQGRYISPP 743  Aeromonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap