3NDZ


Conserved Protein Domain Family
CBM_2

?
pfam00553: CBM_2 
Click on image for an interactive view with Cn3D
Cellulose binding domain
Two tryptophan residues are involved in cellulose binding. Cellulose binding domain found in bacteria.
Statistics
?
PSSM-Id: 425748
Aligned: 13 rows
Threshold Bit Score: 101.756
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3NDZ_E           4 EVTYAITNSWGSGASVNVTIKNNGTTPINGWTLKWTM-PINQTITNMWSASFVASGTTLSVTNAGYNGTIAAnGGTQSFG 82   Clostridium ...
P9WLQ1          41 RATLSVTSTWQTGFIARFTITNSSTAPLTDWKLEFDL-PAGESVLHTWNSTVARSGTHYVLSPANWNRIIAP-GGSATGG 118  Mycobacteriu...
jgi:Celf_3184   36 RVDYAVTNQWPGGFGANVTITNLGDPVS-SWKLDWTY-TAGQRIQQLWNGTASTNGGQVSVTSLPWNGSIPT-GGTASFG 112 
Q9F3Q0          59 KAEYTITSQWEGGFQAGVKITNLGDPV-SGWTLGFTMpDAGQRLVQGWNATWSQSGSAVTAGGVDWNRTLAT-GASADLG 136  Streptomyces...
jgi:Celf_1271  409 QVLWGVN-QWNTGFTANVTVKNTSSAPVDGWTLTFSF-PSGQQVTQAWSSTVTQSGSAVTVRNAPWNGSIPA-GGTAQFG 485 
WP_013133062   361 EATYALVNQWPGGFQAEVTVKNTGSSPINGWTVQWTL-PSGQSITQLWNGDLSTSGSNVTVRNVSWNGNVPA-GGSTSFG 438  Thermobispor...
P54583         466 TASYQVNSDWGNGFTVTVAVTNSGSVATKTWTVSWTF-GGNQTITNSWNAAVTQNGQSVTARNMSYNNVIQP-GQNTTFG 543  Acidothermus...
P23030          38 ACTYTIDSEWSTGFTANITLKNDTGAAINNWNVNWQY-S-SNRMTSGWNANFSGT-NPYNATNMSWNGSIAP-GQSISFG 113  Cellvibrio j...
P27033          38 GCEYVVTNSWGSGFTAAIRITNSTSSVINGWNVSWQY-N-SNRVTNLWNANLSGS-NPYSASNLSWNGTIQP-GQTVEFG 113  Cellvibrio j...
P10476         865 NCQYVVTNQWNNGFTAVIRVRNNGSSAINGWSVNWSY-SDGSRITNSWNANVTGN-NPYAASALGWNANIQP-GQTAEFG 941  Cellvibrio j...
P18126          31 VCEYRVTNEWGSGFTASIRITNNGSSTINGWSVSWNYtD-GSRVTSSWNAGLSGA-NPYSATPVGWNTSIPI-GSSVEFG 107  Cellvibrio j...
jgi:Celf_0019  947 TVVYSTN-SWNVGFTGSVKITNTGTTPLT-WTLGFAF-PSGQQVTQGWSATWSQTGTTVTATGLSWNATLQP-GQSTDIG 1022
AAD16453        35 TATFAKTSDWGTGFGGSWTVKNTGTTSLSSWTVEWDF-PTGTKVTSAWDATVTNSGDHWTAKNVGWNGTLAP-GASVSFG 112  Streptomyces...
3NDZ_E          83 FNINYSGVLSKPTGFTVNGTE 103  Clostridium cellulovorans
P9WLQ1         119 LRGGLTGSYSPPSSCLLNGQY 139  Mycobacterium tuberculosis H37Rv
jgi:Celf_3184  113 FNGSWAGSNPTPASFSLNGTT 133 
Q9F3Q0         137 FVGSGAN--PAPTSFTLNGAT 155  Streptomyces coelicolor
jgi:Celf_1271  486 FNGSHTGTNAAPTAFSLNGTP 506 
WP_013133062   439 FLGSGTGQLSSSITcsas--- 456  Thermobispora bispora
P54583         544 FQASYTGSNAAPT------VA 558  Acidothermus cellulolyticus 11B
P23030         114 LQGEKNGST--AERPTVTGAA 132  Cellvibrio japonicus Ueda107
P27033         114 FQGVTNSGT--VESPTVNGAA 132  Cellvibrio japonicus Ueda107
P10476         942 FQGTKGAGS--AQVPAVTGSV 960  Cellvibrio japonicus Ueda107
P18126         108 VQGNNGSSR--AQVPAVTGAI 126  Cellvibrio japonicus Ueda107
jgi:Celf_0019 1023 FNGSHPGTNTNPASFTVNGEV 1043
AAD16453       113 FNGSGPGS---PSNCKLNGGS 130  Streptomyces coelicolor A3(2)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap