6SLM


Conserved Protein Domain Family
E6

?
pfam00518: E6 
Click on image for an interactive view with Cn3D
Early Protein (E6)
Statistics
?
PSSM-Id: 425729
Aligned: 13 rows
Threshold Bit Score: 114.707
Created: 16-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6SLM_A 401 CVYCKGQLTETEVLDFAFTDLTIVYRDDTPHGVCTKCLRFYSKVSEFRWYRYSVYGTTLEKLTNKGISDLLIRCITCQRP 480
P30735  23 CTFCSRFLTQEELTAFDFSAFNLVWRGRCAHGICTACARVCASLDLFLHHQNSRPLADVLRDENLTLHGLKARCRVCMKI 102 Mastomys natalensis p...
Q07854  27 CIFCSHTVDLADLALFYLKKLSLVFRGNCYYACCSECLRLSALFEQENYFQCSIKAVHLEEIAQKKIKEICIRCICCLRL 106 Human papillomavirus 4
P06930  41 CNFCGNFLNYLEACEFDYKRLSLIWKDYCVFACCRVCCGATATYEFNQFYEQTVLGRDIELASGLSIFDIDIRCQTCLAF 120 Human papillomavirus 5
Q89808  33 CKFCGNNITNIEKLLFDKAGFQLIWRENNAFGCCQYCARVCSVVEQCFGSHRHLTSEELVNVT-KTLQQLSLRCLGCLSI 111 Canine oral papilloma...
P06929  26 CNFCNYFLSNAEKLLFDHFDLHLVWRDNLVFGCCQGCARTVSLLEFVLYYQESYEVPEIEEILDRPLLQIELRCVTCIKK 105 Human papillomavirus ...
P03127  27 CIFCGKLLGAAEKQLFKCTGLCIVWHKGWPYGTCRDCTVLSCALDLYCHLALTAPALEAEALVGQEISSWFMRCTVCGRR 106 Papillomavirus sylvil...
P27555  42 CHYCYKILSVLDIYAFDQSCLYLSWGEGGPTGICSQCTRVLARLEFTARHEVSCAASRLPHFIGQSLSDLEVRCVRCLAL 121 Human papillomavirus ...
Q8UZ19  27 CVFCRTNLRTFEVWSFMTRNLKVLWRKGFPFACCPKCLEVQALVAWLRHFERSGNAKAVEEDTGESLGDLPMRCVGCFKP 106 Omikronpapillomavirus 1
P03126  37 CVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKP 116 Human papillomavirus ...
P11331  11 CIWCKKGLDKVDAKRCHEKKIRIACRNGKHCAVCTSCLENGLYLERSLFPGRPIYPGDLYEPDPWVMFN-DIRCMYCGGC 89  Deltapapillomavirus 1
Q8BDG7  15 CLQCKKALGSLDALKCKNHKYRRVHRGGKPYGMCQICLEALLQLERQEFPWTLLLPKDFVKVLGRLPGDYCVRCYYCGCV 94  Epsilonpapillomavirus 1
Q8QQC2  12 CMWCHEPLTNLDALNFLECNLSMVWRNGTPYGACKACVEFQCFLEVYLHSEGDYRPREVAQEVGRSLCDVRVRCWSCSKP 91  Equus caballus papill...
6SLM_A 481 LSPEEKQR---------HLDKKKRFHNIGGR-WTGRCIAC 510
P30735 103 LSVTEKLE---------CAERGESFAKVRGQ-WRARCRIC 132 Mastomys natalensis papillomavirus (isolate African multimamm...
Q07854 107 LDIVEKLD---------LLYSDETCYLIRGL-WRGYCRNC 136 Human papillomavirus 4
P06930 121 LDIIEKLD---------CCGRGLPFHKVRNA-WKGICRQC 150 Human papillomavirus 5
Q89808 112 LSEADKE----------LCAELNDFSVVRGK-TRGLCSLC 140 Canine oral papillomavirus (strain Y62)
P06929 106 LSVAEKLE---------VVSNGERVHRVRNR-LKAKCSLC 135 Human papillomavirus type 1a
P03127 107 LTIPEKIElrarnctlcCIDKGQYFQ------WRGHCSSC 140 Papillomavirus sylvilagi (STRAIN KANSAS)
P27555 122 LQSVEKDY---------ILREDLSVHRIGGI-WRGTCVRC 151 Human papillomavirus type 41
Q8UZ19 107 MSASEKQF---------QIEDKRPFTKVSGY-WRGFCLNC 136 Omikronpapillomavirus 1
P03126 117 LCPEEKQR---------HLDKKQRFHNIRGR-WTGRCMSC 146 Human papillomavirus type 16
P11331  90 LTRDEKER---------HRLFCEDFWIFRHQ-VRGRCYLC 119 Deltapapillomavirus 1
Q8BDG7  95 LSDSEKDR---------HALDHEGYLYVRGR-ARGRCYSC 124 Epsilonpapillomavirus 1
Q8QQC2  92 LTKNEKQE---------IELLGKPLTKVRHKeWRALCYNC 122 Equus caballus papillomavirus 1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap