4WED,5MWU,3T66,1UQW,2WOL,1B51,5IPW,3I5O,5ISU


Conserved Protein Domain Family
SBP_bac_5

?
pfam00496: SBP_bac_5 
Click on image for an interactive view with Cn3D
Bacterial extracellular solute-binding proteins, family 5 Middle
The borders of this family are based on the PDBSum definitions of the domain edges for Salmonella typhimurium oppA.
Statistics
?
PSSM-Id: 425718
Aligned: 151 rows
Threshold Bit Score: 133.301
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4WED_A  76 QIEPCLATD-W-----------------KIEDGGKTLHLTLREGVKFQDGTKFDAAACKWNLERWXGIDQFSWXNCSkh- 136 Sinorhizobium melilot...
Q2FZR2  87 irpkayiASw------------------KDIEPAKKIEFKIKKGIKWHDGNELKIDDWIYSIEVLANKDYEGAYYPSven 148 Staphylococcus aureus...
Q9K6U0 103 AQVLQWFDDaLidwdenyvmtqdgaatyEISEDGRTFTFTIRDNVNWHDGEPVTAEDWAFAHEVIGHPNYDGIRFDDtlr 182 Bacillus halodurans
Q1G9K6  87 nitdsgAAS-F-----------------SLDRQAKQITINIKKGVKWSDGKQIVAKDVEYAYEVIANKATKSSHYTSslq 148 Lactobacillus delbrue...
Q82ZF4  84 AQYMLPTVQpLfnndadfkivdggpadlKLDEDANTATIKLRDNLKWSDGKDVTADDVIFSYEVIGHKDYTGIRYDDnft 163 Enterococcus faecalis
Q2YPL6 108 tqYPLIASA-L-----------------QYPDDFSWVKFKLNPDAKWHDGQPITVDDVIWSFNVLKKQSPMYNQYYSdv- 168 Brucella abortus 2308
Q2YPL7 107 sVYGLIAESv------------------TLSKDRKTCTFKLRKEARFHDGSPIEASDVAFTYKTFKEKGHPTLRQSLag- 167 Brucella abortus 2308
O25845  91 AEYPLIAKDaE-----------------V-AKDNSYVIFTIDKRARFSNNAPILASDVKFSFDTIMKLGSPIYRQYYqd- 151 Helicobacter pylori
Q880X1 103 TVYGLIAEKmE-----------------R-GADGLSLRFYLNPKARFADGTPITANDVKYTYELLMTQGNLQYRTQFea- 163 Pseudomonas syringae ...
Q8Y071 106 SGYGLLADDvS-----------------V-APDELSVTFHLNPLARFSNGDPVRAADVKYSYDMLMGKGASPAYRSMtad 167 Ralstonia solanacearum
4WED_A 137 --------------------fqSLEVVDDYHITVHFKEP-----------VLALXQELSYTRPtr----------flSPK 175 Sinorhizobium melilot...
Q2FZR2 149 iqgakdy------hegktdhisGLKKIDDYTMQVTFDKKqenyl-tgfitGPLLSKKYLSDVP--------------IKD 207 Staphylococcus aureus...
Q9K6U0 183 nvegieey---hngeadhisgiEVVDEKTLKITYKKATPslmt---ggvwYYPLAKHIFGDMD--------------IED 242 Bacillus halodurans
Q1G9K6 149 dvvglkeyhdgkaktisgiempDGENGRKVVIHFKEMHPgmlksgngyfwESALPYHYLKNVP--------------FSK 214 Lactobacillus delbrue...
Q82ZF4 164 nivgmedy---hdgksptisgiEKVNDKEVKITYKEVHPgmqqlgggvwgs---------------vlpkhafegiaVKD 225 Enterococcus faecalis
Q2YPL6 169 ---------------------eSAEKTGEHEVKFTFSRKgn-------reLPQIMGQLAILPKhwwta-----kdarGKQ 215 Brucella abortus 2308
Q2YPL7 168 --------------------lqKVEATAKHEVQMHFAAGrg--------pNAILDAVTLPIISek-----------wFKG 208 Brucella abortus 2308
O25845 152 --------------------vkKAVVLDKHHVKFIFKTTen--------kELPLILGQLQIFSkk-----------aFQE 192 Helicobacter pylori
Q880X1 164 --------------------vkGLEVESPTQIRFDFKHSds--------rTLPLDLASLPVFPeh----------wwKTR 205 Pseudomonas syringae ...
Q8Y071 168 --------------------vsKVTVMDERTIRYDFKRRnk--------eLPLIVGNLPVFSPkwgkgsgkpddpegGKD 219 Ralstonia solanacearum
4WED_A 176 SVDADGKFKEPVGTGP-----WVQisaddTQSvFEHYDG-Yw-------GDKPTYERLEAKVIpDARSRVAAL-RAGEID 241 Sinorhizobium melilot...
Q2FZR2 208 LAKSDKIRKYPIGIGPykvkkIVPg---eAVQ-LVKFDD-Yw-------QGKPALDKINLKVI-DQAQIIKAM-EKGDID 273 Staphylococcus aureus...
Q9K6U0 243 ISSSPEVRQNPIGFGPfkvenVVPg---eSVV-YSKNED-Yw-------RGEPNLDEVVLKVV-SPNVVMQSL-RSGEVD 308 Bacillus halodurans
Q1G9K6 215 LRTCIEIRKKPLYFGPykvqsIEAg---qKVV-WTRNEY-Yw-------RGTPSLSKITISII-SPKSVSTAI-KERTY- 279 Lactobacillus delbrue...
Q82ZF4 226 MESSDAVRKNPVTIGPyymsnIVTg---eSVE-YLPNEHyY--------GGKPKLDKLVFKSV-PSASIVEAM-KAKQYD 291 Enterococcus faecalis
Q2YPL6 216 RDITRPTLEIPLGSSAykiesMKPg---hSII-WARVED-YwgkdlpvnVGRNNFDHVAYEYYfNEDATWEAFkKGGQYD 290 Brucella abortus 2308
Q2YPL7 209 RNFEATSMEPVLGSGAykvgnFSAg---hFIE-YDRVED-YwakdlpvqKGSNHFDRIRIEFFhDRQPAFEAF-KKGSID 282 Brucella abortus 2308
O25845 193 DYFEKNPLLIPVSSGPyviasFDVg---kKIT-YQRNPN-YwarnlpsrKGQFNFDQIKFEYYkDETIALQAF-LSGAYD 266 Helicobacter pylori
Q880X1 206 DFASGAGFEIPPGSGPytishVDPg---rTIT-FERDPN-WwgkdlpvsKGLYNFDKFSIEYF-GDIDVARTVlKGGAYD 279 Pseudomonas syringae ...
Q8Y071 220 TPFDKITFQEPIGSGPylierYDGa---rGIT-FRRNPD-YwgrnlnvrRGAYNFEHIQYKLYkDETARLEAF-KAGEYD 293 Ralstonia solanacearum
4WED_A 242 LVGGFWIAPLTPEegkqLEAAGFNV--------VVDPGNVTLVXAFNPDr------------AEPLKDPQVRKAVSIGID 301 Sinorhizobium melilot...
Q2FZR2 274 VANDATGAMAKDA----KSSNAGLKv-------LSAPSLDYGLIGFVSHdydkka-nktgkvRPKYEDKELRKAMLYAID 341 Staphylococcus aureus...
Q9K6U0 309 LVHSFPADQFPDN----ADTSNLDW--------LGVVDRAYTYIGFKLGtwedge--vktdpDAKMADVNLRRAMWHAID 374 Bacillus halodurans
Q1G9K6 280 DIIEVVNSQWQQI----RTTKNYKF--------VATIPLSYNYLGFKLGkwdektnsvkmnkNSKMANKSLRQAIGYAMN 347 Lactobacillus delbrue...
Q82ZF4 292 IALSMPTDTYPTY----KDTEGYQI--------LGRPEQAYTYIGFKMGtfdketntvkynpKAKMADKSLRQAMGYAID 359 Enterococcus faecalis
Q2YPL6 291 YRNENRAQRWAEQ----YNFPAVQRgdvvkasfPFRAVGRMQGYFLNTR-------------RDKFKDPKVREALTYAFD 353 Brucella abortus 2308
Q2YPL7 283 FCEENVAKNWATA----YDFPAIHQkkvirrtfPREKRPLMQAWAVNQR-------------RERFRDPRVREAIGLCFD 345 Brucella abortus 2308
O25845 267 WRLESTAKVWARG----YVGKAMDNkeitkyliAHKMPSGMQGFFFNTR-------------REIFKDKRVREALFYAFD 329 Helicobacter pylori
Q880X1 280 YNREFSATGYSIR----YDGPALSDgrlqkaqlATGAVQSSQGFIFNLS-------------RPMFQDRRVRQALSLLWD 342 Pseudomonas syringae ...
Q8Y071 294 AMVEYRAKNWAKS----YVGVKFRSgelvksefPHRNGAGMQGFVMNLR-------------KPIFRDLRVRRALVLALD 356 Ralstonia solanacearum
4WED_A 302 RAAISKVLYHGYAKPAGNXFSAALPYAGKQFDAPVR------------------------------------DAAAASAL 345 Sinorhizobium melilot...
Q2FZR2 342 REKWIKAFFNGYASEINSFVPSMHWIAANPKDLNDYk----------------------------------yDPEKAKKI 387 Staphylococcus aureus...
Q9K6U0 375 NDAVGERFYHGLRWAGTTLIPPSHPEFHDDTNPGRAy-----------------------------------DPELAKQL 419 Bacillus halodurans
Q1G9K6 348 VTQIQRKYTSGLTFRIKSLIPLQFGDYYDDKSKGYp-----------------------------------yNPAKAKKL 392 Lactobacillus delbrue...
Q82ZF4 360 NDAVGQKFYNGLRTGATTLIPPVFKSLHDSEAKGYTl-----------------------------------DLDKAKKL 404 Enterococcus faecalis
Q2YPL6 354 FESMNRLMFYNQYKRINSYFAGNELALSGPPTPAEQailetvkdalpadalt----kefklpvydtpqatreNLRTALKL 429 Brucella abortus 2308
Q2YPL7 346 FEWSNKNLFYEAYTRSQSCFNGSDFQANGLPSPDEMkilaryrgklpeavfg----eavlvpvsdgtgrdrkQFTQAIKL 421 Brucella abortus 2308
O25845 330 FEWANKNLFFSQYKRTTSFFSNSIYASPPLPSPEEKallapyeksldervfkepyvvprtdgvdvlgynlreNLKYAQKL 409 Helicobacter pylori
Q880X1 343 FEWTNRQMMRNMYIRQDSYFSNSELAASQLPTpaelkileplrgtvpkev----fdtvfktpktdgtglirdKQLQALAL 418 Pseudomonas syringae ...
Q8Y071 357 FEWLNRQQFYGAYRRLDSYFANSELAASDSVTGQPGkgelalleplrgkldaevfgvlqappstdppgslrdNLRQARRL 436 Ralstonia solanacearum
4WED_A 346 LEKAGWTGSPIRSKDg----kPLTLELVVSPD-AVPGSrVIAEVIQSEXKEVGIDLVIRSVdHAs------kHTD----- 409 Sinorhizobium melilot...
Q2FZR2 388 LDKLGYKDRDGDGFRedpkgnKFEINFKHNSGsNPTFE-PRTAAIKDFWEKVGLKTNVKLV-EF--------GKYnedla 457 Staphylococcus aureus...
Q9K6U0 420 LDEAGYEDVDGDGFRedlegnELVINFASMSG-GDIAE-PLAQYYIQAWEQVGLKVQLLDGrLHefnafydrVEE----- 492 Bacillus halodurans
Q1G9K6 393 LDKAGYKLRPGEKYRrdpqghKLVIHLAAMTG-DASQS-KIINNYIKKWKEIGLNVKLTTGhLLe------fNTFynllf 464 Lactobacillus delbrue...
Q82ZF4 405 LDDAGYKDVDGDGIRedkegkPLEIKFASMSG-GETAQ-PLADYYVQQWKEIGLNVTYTTGrLIdfqafydkLKN----- 477 Enterococcus faecalis
Q2YPL6 430 FSQAGWTLKGNTLVDa----kGNPFTIEFLGQ-DPTDE-RIYNPFAASLRKIGINATVRIV-DA--------AQYqa--r 492 Brucella abortus 2308
Q2YPL7 422 MEEAGFERRHGHFHDh----dGSNFALEILCN-SEAVT-RIYNPFAQKLRAIGIDTSLRLV-DA--------SQYqa--r 484 Brucella abortus 2308
O25845 410 LESTGFSYKNMRLVDk----nNKPFSFTLLLN-SPAFE-RLALAFAKNLRVLGIEMKIQRV-DL--------SQYvn--r 472 Helicobacter pylori
Q880X1 419 MKEAGWTPKGDELVNa----qGEPFSFTFLNA-QSGFE-RMLLPYKRTLAQIGIHFDIRRI-DS--------AQYln--r 481 Pseudomonas syringae ...
Q8Y071 437 LAQAGWTYSDGALRNt----kGEPFTFEMLDD-GGAMS-RVMAAYVRNLEKLGIRVNQRIT-DY--------ALYqk--r 499 Ralstonia solanacearum
4WED_A 410 XLEQKYDLGFFLTYGAPYDPFGSLVALCLSTFKND 444 Sinorhizobium meliloti 1021
Q2FZR2 458 NASKDMEVYFRSWAGGTDPDPSDLYHTDRPQnemr 492 Staphylococcus aureus subsp. aureus NCTC 8325
Q9K6U0 493 -DDPDIDIYQGAWGVGIDVDPSGLYGRRAPFNYTR 526 Bacillus halodurans
Q1G9K6 465 QDDSQVDMFIAGWTLNNEPSQNGIYGAGTqynler 499 Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 = JCM 1002
Q82ZF4 478 -DDPEVDIYQGAWGTGSDPSPTGLYGPNSAFNYTR 511 Enterococcus faecalis
Q2YPL6 493 VNDFDYDVITAVIAQTASPGNEQRDMWGSKAAdfk 527 Brucella abortus 2308
Q2YPL7 485 LQDFQFDMVGVALQFSATPTKESLAGIFGSdsaki 519 Brucella abortus 2308
O25845 473 IKSYDFDMIVGVIGQSSFPGNEQRFYFGSLSAKEK 507 Helicobacter pylori
Q880X1 482 VMARDYDMIVTGYPVSTSPGAELYNSFGSKVAMDP 516 Pseudomonas syringae pv. tomato
Q8Y071 500 LEEFDFDMISLRFPDSSSPGNELKDRFGSAAADEQ 534 Ralstonia solanacearum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap