6J3Y


Conserved Protein Domain Family
PSII

?
pfam00421: PSII 
Click on image for an interactive view with Cn3D
Photosystem II protein
Statistics
?
PSSM-Id: 425673
Aligned: 17 rows
Threshold Bit Score: 431.164
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6J3Y_B             1 MALPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGSMALYELAVFDPSDPVLNPMWRQGMFVMPFMTRLGITDSWGG--W 78  
ABK20730           1 MALPWYRVHTVVLNDPGRLISVHLMHTALVAGWAGSMALYELAVFDPSDPVLNPMWRQGMFVMPFMTRLGITDSWGG--W 78  
YP_003097505       1 MGLPWYRAHTVVSNDPGRSLPVHLMHTALVSGWAGPMAPYELAVSDPSDPALDPMRRQGMSVIPLTTRPGVTESWSG--W 78  
XP_016719338       1 MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGG--W 78  
ASGPB:GKIL_2487   19 edFAWWAGNARLINLSGKLLGAHVAHAGLIVFWTGAMTLFELSHFEPA----KPMYEQGLILLPHLAALGWGLGTGAngY 94  
WP_015153119      27 TGYAWWAGNARFINLSGRFLGAHVAHAGLVAFWAGAMLMFEVAHYVPE----KPMYEQGLILMPHIATLGFGVGQGG--- 99   Chroococci...
jgi:Syn6312_2476  19 sGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFETAHFIPE----KPMYEQGLILLPHIATLGWGVGPGG--- 91  
jgi:Cyagr_1171    20 TGYAWWAGNARLINLSGRLLGAHVAHAGLMVFWAGAMMLFEVSHFTFD----KPMYEQGLILFPHVATLGYGVGPGG--- 92  
tgen:AM1_1084     43 TGYGWWAGNARLTDLSGQLTGAHIAHAGMITFWAGAMTLFEVSHFIPE----KPMYEQGSILLAHLAAEGFGVGPGG--- 115 
P20093             1 MGLPWYRVHTVVLNDPGRLISVHLMHTALVAGWAGSMALYELAIYDPSDPVLNPMWRQGMFVLPFMARLGVTQSWGG--W 78   Nostoc sp....
6J3Y_B            79 SITGESVSNPGIWSFEGVALSHIILSGMCFLAAIWH-------------WVYWDLELFRDPRTGEPALDLPKIFGIHLFL 145 
ABK20730          79 SITGESVSNPGLWSFEGVALSHIVLSGMCFLAAIWH-------------WVYWDLELFRDPRTGEPALDLPKIFGIHLLL 145 
YP_003097505      79 SIAGETVTNAGIRSYEGVATAHIVPPGLLLLAAIWH-------------WVYWDSEISSDERTGTFALDLPKISGVHPSP 145 
XP_016719338      79 SITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWH-------------WVYWDLEIFCDERTGKPSLDLPKIFGIHLFL 145 
ASGPB:GKIL_2487   95 QVVD-------TWPYFVVGVLHLISSAVLGFGGIYHsiwgp---dilsgFFGYD---WKDKN------KMTTILGIHLIL 155 
WP_015153119     100 QVVD-------IFPFFAIAAIHLIGSAVLGFGGVYHsikgp---erlagFYDFD---WTDKD------KVTSILGYHLIA 160  Chroococci...
jgi:Syn6312_2476  92 EVID-------TFPFFVVGVLHLISSAVLGFGGIYHavrgpetleeyssFFGYD---WKDKN------KMTTILGFHLIV 155 
jgi:Cyagr_1171    93 EVTD-------LYPFFVVGVLHLISSAVLGLGGLYHalrgpeilenysaFFSQD---WRDKN------QMTNIIGYHLIL 156 
tgen:AM1_1084    116 EVIS-------TYPYFVIGAIHLIASAVLGFGGLYHtfrgpakfedysdWWGYD---WEDKE------KMMQILGIHLIF 179 
P20093            79 SVTGGTATDPGFWSFEGVAAAHIVLSGLLFLAAVWH-------------WVYWDLELFRDPRTGEPALDLPKMFGIHLFL 145  Nostoc sp....
6J3Y_B           146 SGLLCFGF--GAFHVTGLfgpGIW--------------VSDA-------YGITGKVQPVAPAWGADGFNPFNPGG----- 197 
ABK20730         146 SGLLCFGF--GAFHVTGLfgpGIW--------------VSDA-------YGITGKVQPVAPSWGADGFNPFNPGG----- 197 
YP_003097505     146 PGVPRFGF--GASHVTGLlgpGIW--------------VSDP-------YGLTGRIEPVAPVWTAAGFDPFVPGG----- 197 
XP_016719338     146 SGVACFGF--GAFHVTGLygpGIW--------------VSDP-------YGLTGKVQPVNPAWGVEGFDPFVPGG----- 197 
ASGPB:GKIL_2487  156 LGIGAFLLvaKACWFGGLyd--pWyyenanqwagqvrvVTNPtldpsiiFGyv-------------lkSPFGGGGwiisv 220 
WP_015153119     161 LGLGALLLvaRAMYLGGLyd--tWapggg-----dvrvVTNPtldpriiFGyl-------------fkGFTGGAGniasv 220  Chroococci...
jgi:Syn6312_2476 156 LGIGAFLLvlKAMFFGGVyd--tWapggg-----dvrvITNPtlnpaviFGyv-------------lkSPFGGDGwivsv 215 
jgi:Cyagr_1171   157 LGVGALLLvfKAMFFGGVyd--tWapggg-----dvrlISNPtlspgviFGyl-------------trAPFGGEGwiigv 216 
tgen:AM1_1084    180 LGIGALAFaaKAMFFGGLyd--pWapggg-----nvrlITNPtwnlgtfLGyi-------------trSPWGEGGwivsv 239 
P20093           146 SGLLCFGF--GAFHLTGLfgpGMW--------------ISDP-------YGVTGSVQPVAPEWGPDGFNPFNPGG----- 197  Nostoc sp....
6J3Y_B           198 -----IAAHHIAAGIFGIFAGIFHLTVRPPQRLYRALRMGNIETVLSSSISAVFFAAFVTSGTMWYGAAATPIELFGPTR 272 
ABK20730         198 -----IAAHHIAAGIFGIFAGIFHLTVRPPQRLYRALRMGNIETVLSSSISAVFWAAFVTSGTMWYGAAATPIELFGPTR 272 
YP_003097505     198 -----IASHHIAAGILGILAGLFHPSARPPQRSHKSLRMGNVETVSSSSIAAVPLAALVVAGTMWYGSATTPVEPFGPTR 272 
XP_016719338     198 -----IASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTR 272 
ASGPB:GKIL_2487  221 dnledVVGGHIWIGIICISGGIWHIVTKPWGWAQRSL-IWSGEAYLSYSLGALSLMGFIAASYVWFNNTVYPSEFYGPTE 299 
WP_015153119     221 nnledIVGGHIWMGSILIAGGIWHVLTKPFKWAERVF-IWSGEAYLSQSLGNVAGQALIAACFIWFNNTAYPSEFYGPTA 299  Chroococci...
jgi:Syn6312_2476 216 dnmedIIGGHIWLGLICISGGIWHILTKPFGWARRAF-IWSGEAYLSYSLGALSLMGFIACCFVWFNNTAYPSEFYGPTG 294 
jgi:Cyagr_1171   217 dsmedIIGGHIWIGLICIFGGIWHVITKPFGWVRRAF-IWNGEAYLSYSLGALSFMSFIASAYIWFNNTAYPSEFYGPTN 295 
tgen:AM1_1084    240 nnledVVGGHLLVGVHYIFGGVFHILVKPWGWVRRAY-VWSGEAYLSYSLGALYMCGMIAVGYVWFNNTVYPSEFYGPTA 318 
P20093           198 -----VVAHHIAAGIVGIIAGLFHLTVRPPERLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGNATTPIELFGPTR 272  Nostoc sp....
6J3Y_B           273 YQWDSGYFQQEIERQVETSVSEGLSESQAWSRIPDKLAFYDYIGNNPAKGGLFRAGPMNKGDGIAEAWLGHPIFRDKEGR 352 
ABK20730         273 YQWDSGYFQQEIERQVESSVTEGLSESQAWSRIPDKLAFYDYIGNNPAKGGLFRSGPMDKGDGIAEAWLGHPIFRDKDGR 352 
YP_003097505     273 YQWDLGFYQQETDRRIRSARAGNIGLPEAWSKIPEKSASHDHIGSNPAKGGSSRAGATDSGDGIAVGRLGHATPRDKEGH 352 
XP_016719338     273 YQWDQGYFQQEIYRRVSAGLAENQSLSEAWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKDGR 352 
ASGPB:GKIL_2487  300 ME---------------------ASHAQNFVFMARDIKLGTDIGAAQGPTGL--------GKYLMRSPSGQVIYGGETMR 350 
WP_015153119     300 PE---------------------ASQAQALNFLVRDQQLGANVVSAQGPTGL--------GKYLMRSPTGEIIFGGETMR 350  Chroococci...
jgi:Syn6312_2476 295 PE---------------------ASQAQAMTFLVRDQKLGANVGSAQGPTGL--------GKYLMRSPSGEIIFGGETMR 345 
jgi:Cyagr_1171   296 AE---------------------ASQAQSFTFLVRDQRMGANIGSAMGPTGL--------GKYLMRSPTGEIIFGGETMR 346 
tgen:AM1_1084    319 AE---------------------ASQAQAMTFLIRDQRLGANIASAQGPTGL--------GKYLMRSPSGEIIFGGETMR 369 
P20093           273 YQWDQGYFHQEIERRVQSSVAQGASLSEAWSQIPEKLAFYDYVGNSPAKGGLFRTGPMVKGDGIAQSWQGHGVFKDAEGR 352  Nostoc sp....
6J3Y_B           353 ELTVRRMPAFFETFPVILVDKDGIIRAD----IPFRRAESKYSIEQVGVTVDFYGGKLNGQTFKDAPTVKK---FARKAQ 425 
ABK20730         353 ELTVRRMPAFFETFPVILVDKDGIIRAD----IPFRRAESKYSIEQVGVTVDFYGGKLNGQTFKDAPTVKK---FARKAQ 425 
YP_003097505     353 EPFVRRMPTLLETSPVVLVDEEGIARAD----VPSRRAESKYSAEQVGVTAEFCGGELDGVSFSDPATVKK---HARRAQ 425 
XP_016719338     353 ELFVRRMPTFFETFPVVLVDGDGIVRAD----VPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKK---YARRAQ 425 
ASGPB:GKIL_2487  351 FWSIKT--------PLDEMLKDGVEIRDhklvYPQ-GGTTGYSVEKLMTGIQ-------------PWQVRRateYMTHAA 408 
WP_015153119     351 FWDFKG--------PWLE---------------PL-RGPNGLDLEKIRYDIQ-------------PWQIRRaseYMTHAP 393  Chroococci...
jgi:Syn6312_2476 346 FWDFRG--------PWLE---------------PL-RGPNGLDLNKIKNDIQ-------------PWQARRaaeYMTHAP 388 
jgi:Cyagr_1171   347 FWDFRG--------PWLE---------------PL-RGPNGLSLDKLQNDIQ-------------PWQVRRaaeYMTHAP 389 
tgen:AM1_1084    370 FWDFRG--------PWLE---------------PL-RGPNGLDLNKLRNDIQ-------------PWQARRaaeYMTHAP 412 
P20093           353 ELTVRRLPNFFETFPVILTDADGVVRAD----IPFRRAESKYSFEQSGVTVSFYGGDLDGKTFTDPADVKK---YARKAQ 425  Nostoc sp....
6J3Y_B           426 LGEVFEFDrtSLESDGVFRSSPRGWYTYGHANFALLFFFGHLWHGGRTIFRDVFTGIGAEVTEQVEFGAFQKLGD 500 
ABK20730         426 LGEVFEFDrtSLESDGVFRSSPRGWYTFGHANFALLFFLGHLWHGGRTIFRDVFTGIGAEVTEQVEFGAFQKLGD 500 
YP_003097505     426 LGEIPESDraTSKPDGVPRSSPRGWSTFGHATFALLSSSGHIRHGARTPFRDVLAGTDPDPDAQAELGTSQKSGD 500 
XP_016719338     426 LGEIFELDraTLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFAGIDPDLDAQVEFGAFQKLGD 500 
ASGPB:GKIL_2487  409 IGSLNSVGgvATEINTINYTSPRIWLAGSHFILAFFLLVGHLWHAGRA--RAANAGFEKGISRSLEgv------- 474 
WP_015153119     394 LGSLNSVGgvATEINSFNYVSPRAWLASAHFVFAFLFLVGHLWHAGRA--RAAAAGFERGIDREDEP-VLSMPPL 465  Chroococcidiops...
jgi:Syn6312_2476 389 LGSLNSVGgvATEINSVNFVSPRSWLSTSHFVLGFFFLVGHLWHAGRA--RAAAAGFEKGIERETEA-VLSMPNL 460 
jgi:Cyagr_1171   390 NASLNSVGgiITEPNSVNFVNIRQWLASTQFVLAFFFLVGHLWHAGRA--RAAAAGFEKGIDRQAEP-TLAMPDL 461 
tgen:AM1_1084    413 LGALNSVGgvATEINSVNYVSPRSWLSTSHFCLAFFFFVGHIWHSGRA--RAAAAGFEKGIERKTEY-ALSLpdi 484 
P20093           426 GGEIFEFDreTLNSDGVFRTSPRGWFTFGHAVFALLFFFGHLWHGARTIYRDVFAGVEADLEEQVEWGLFQKVGD 500  Nostoc sp. PCC ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap