1QB4


Conserved Protein Domain Family
PEPcase

?
pfam00311: PEPcase 
Click on image for an interactive view with Cn3D
Phosphoenolpyruvate carboxylase
Statistics
?
PSSM-Id: 425598
Aligned: 46 rows
Threshold Bit Score: 1129.2
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QB4_A                 8 LRSNVSMLGKVLGETIK--DALGEHILERVETIRKLSKSSra----gNDAnrqELLTTLQNLSNDELLPVARAFSQFLNL 81   Escher...
Q2SL23                 9 LRENVRLLGELLGQSIR--YHLGDEIFNKIEKIRIAAKADrn----aEISqrkQLKEVLSGLNDEELAPVARAFNQFLNL 82   Hahell...
CASKLGSI:MRBBS_2642    8 LRENVRMLGELLGQSIR--QHLGQQCFDTIEQVRAAAKADrl----qESGsgqRLVNLLGQLGDEEILPVTRAFNQFLNL 81   Marino...
Q8EK30                 8 LRSNVSMLGQILGDTMR--THLGDSFLEKVEQIRKLAKDSrr----gDEAareQMLELLTALPDEELVPFAKAFNQFLNL 81   Shewan...
Q87L54                 8 LKSNVRMLGHLLGNTIR--DAHGEEIFEKVETIRKLSKSAqa----gNQAdreSLIEEIKHLPDEQLTPVTRAFNQFLNL 81   Vibrio...
Q54JZ3                19 LDKSITKFQNILSNCIKdlETDGEEIIKLVKTLILTQSPge-----rTTEfieEYLKKISNLSNTEALNVSRVLSHLLNL 93   Dictyo...
XP_006370158          34 IEYDALLLDRFL-DILQ--DLHGEDLKETVQECYELSAEYeg---khDPKkleELGSVLTSLDPGDSIVIAKSFSHMLNL 107  black ...
XP_001760595          26 VEYDSILLDRFL-NVLQ--DLHGSDVKETVEKCYELSGMYsrvegqgDLEkleRLGELLNNLDAGDSIVVASSFSHMLNL 102  Physco...
XP_001420862          57 IEECDELLRTIFFAVVR--ETAGDKFLGQLKSVYEASEKFgs---shDPKdfdAMQAMLETMEVDESLQFASAYSNLLNL 131  Ostreo...
jgi:MICPUN_104763     36 LQESDDLIRALFFSIVK--ETTGTEFFQSLKDVYDLSEKFhe---tqAQSdfdALTTKLGSLTNEETMMLASAFSNVLNL 110  Microm...
1QB4_A                82 ANTAEQYHSISPKGEAASNP------------EVIARTLRKLKNQpELSEDTIKKAVESLSLELVLTAHPTEITRRTLIH 149  Escher...
Q2SL23                83 TNIAEQYHIVRRRAPASELVdn--------rlDTIEVVFDRLIGQ-GVSKDKFFAQLADLNLEFVLTAHPTEITRRTLIQ 153  Hahell...
CASKLGSI:MRBBS_2642   82 ANLAEQYHGIRRNRGHSADLm----------vESFSEVFQRLLAG-GISADELHRQVVNLRVEFVLTAHPTEVTRRTLIM 150  Marino...
Q8EK30                82 ANLSEQFHTISRNCDELVCVp-----------DPVEQLLGRMLNG-RVDQTKMLDCLKTLDIDLVLTAHPTEISRRTLIQ 149  Shewan...
Q87L54                82 TNIAEQYHTISRHCEEHICEp-----------DAINSLFSKLVQN-DVSKLDTAQAVRDLNIELVLTAHPTEITRRTMIN 149  Vibrio...
Q54JZ3                94 INVAEQHHLVRSVRESFLNNedd-------lkYSCENTIQQLLNQ-GLDKESVYNALIQQKIELVLTAHPTQIMRRTIIS 165  Dictyo...
XP_006370158         108 ANLAEEVQIAYRRRNK-LKKgdfadennatteSDIEETLKRLVSEmKKSPEEVFDALKNQTVELVFTAHPTQSVRRSLLQ 186  black ...
XP_001760595         103 GNLAEEVQIAYRRRVKMAKKgdlgdensalteSDLEETFRRLVNQiGKTPAEIFEALKHQTVDLVLTAHPTQSVRRSLLQ 182  Physco...
XP_001420862         132 HNISEQVANAMEERHRRLDDipr------gpaKTTNGAIKGLLRA-GKSTEEIYSALAVQHVDLVLTAHPTQALRRSMLK 204  Ostreo...
jgi:MICPUN_104763    111 HNVSEHVASAMEERHARLDDipr------gpaKTTNGAIKGLVAK-GISKEAIYKAITEQEVDLVLTAHPTQALRRSMLK 183  Microm...
1QB4_A               150 KMVEVNACLKQLDNKDIADYEHNqLMRRLRQLIAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLE 229  Escher...
Q2SL23               154 KYDQISECLESLDRSDLLDEEYAkIVERLRRLITEAWHTDEIRYERPTAVDEAKWGFAVIENSLWQAVPDFMRQMDAALL 233  Hahell...
CASKLGSI:MRBBS_2642  151 KYDDMSDCLEQLDHQDLMPSERDgIVRRLTRLIAEAWHTDEIRYDRPTAVDEAKWGFAVIENSLWTALPRFLESLDTALV 230  Marino...
Q8EK30               150 KYAAIVDCLAEQENNQLSDRERQqINLRLRQLIAQIWHTNEIRRERPTPVDEARWGLSTIEESLWHAVPDFLRQLNDQVQ 229  Shewan...
Q87L54               150 KLVKINECLSKLELSDLSSKERKkTERRLEQLIAQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWEAVPDFLREMNDRLK 229  Vibrio...
Q54JZ3               166 KNSAMGEALSSLDNQQLTMFEREdYEKRLIREVGGSWLTDEVRRSKVTVEMEAQGGFSVIEQTLWHALPKFIKILNRCCV 245  Dictyo...
XP_006370158         187 KHARIRNCLAQLYAKDITPDDKQeLDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALK 266  black ...
XP_001760595         183 KHTRIRSCLSQLNQVDITSDERQeLDEALHREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGLPIFLRRVDTALK 262  Physco...
XP_001420862         205 SFGIIREKLLQLQRFRLSRYERAeVLDEIRSKVASAWRTDEIRRTPPKPQDEMRAGLTYFQQTIWDGIPTFMRRVDTSLL 284  Ostreo...
jgi:MICPUN_104763    184 NFGTVRQKLLDLQRARLSGYERAeLLDSMASAIQSAWRTDEIRRTPPKPQDEMRAGLSYFNETVFEGLPKFCRRIDSALI 263  Microm...
1QB4_A               230 ENL-GYKLPVEFVPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVE----ATPELLALVG 304  Escher...
Q2SL23               234 ERF-GEGLPINVNPVRFASWMGGDRDGNPNVTSEVTREVFLLSRWMAADLYLRDIEALRSELSMTA----CNGELARASG 308  Hahell...
CASKLGSI:MRBBS_2642  231 EAT-GKGLPLQATPVRVASWMGGDRDGNPNVTHQVTREVFLLGRWMAADLYMKDITALRAELSMWQ----ASDELRARVG 305  Marino...
Q8EK30               230 ERT-GQQLPIDIAPVRFSSWMGGDRDGNPFVTAKVTQEVLDRNRHAAARLFLKDIVLLVGELSMEE----ANDELKAYTN 304  Shewan...
Q87L54               230 SYL-GEGLPIDARPVHFSSWMGGDRDGNPFVTHSVTREVLLLSRWKAADLYLNDINELISELSMTV----SNDQVRELAG 304  Vibrio...
Q54JZ3               246 KYL-GKELPPTFANIHVASWVGGDRDGNHNVTAEVTRQVSYFSRWIAATLYYKEIDALLFELSMVRhnktLEELARHSIE 324  Dictyo...
XP_006370158         267 NIGiNERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANLYYSQIEDLMFELSMWR----CSDELRLRAD 342  black ...
XP_001760595         263 AIGvEERLPYDVPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARLMAANLYFAQIEDLMFELSMWR----CSDELRNRVV 338  Physco...
XP_001420862         285 ANG-CPRLPLDRSIVTFGSWMGGDRDGNPYVTASCTRDVVLLARVQGVNLLFRAIQRLIFDLSMWR----CNDAVKALAK 359  Ostreo...
jgi:MICPUN_104763    264 NQG-LPRIPMEHSIMRFSSWMGGDRDGNPFVTATCTRDVVYLARITAVNLYFKAIQDLIFSLSMWR----CTDAFRERAR 338  Microm...
1QB4_A               305 ---------------------------EEGAAEPYRYLMKNLRSRLMATQAWLEARLKGEEL---PKPEGLLTQNEELWE 354  Escher...
Q2SL23               309 -----------------------------QSREPYRKILAKLRSRLEATRAWAAEALDSTK----KPAAEVLLNNAELIE 355  Hahell...
CASKLGSI:MRBBS_2642  306 -----------------------------DTREPYRQILGELRDQLSRTRDWAEASISGAA----ADSNGILFANSEFTE 352  Marino...
Q8EK30               305 -----------------------------NSCEPYRFVLRSLRQKLRDTIDYLNARIEGHNPe--VDKSTLIWQESDLKA 353  Shewan...
Q87L54               305 ----------------------------EDQHEPYRAILKQLRALLNETKDILDAKIHGQK----LAVKAPLQKVEQLWD 352  Vibrio...
Q54JZ3               325 krsgtvklry-------lttlykefkeGIPSKECYRIVMAELRDKMLLTKRKYEDLIAAKSDt-qYLPGETFENADEILQ 396  Dictyo...
XP_006370158         343 elhrsskrd---------akhyiefwkQIPPNEPYRVILGELRDKLYQTRERSRQLLSHGISe--IPEEATFINVEQFLE 411  black ...
XP_001760595         339 qltgatkke---------akhyiefwkTIPSTEPFRVVLGDVRDKLYQTRERMRQQLSSGKSe--IALDETFTDKSQIIE 407  Physco...
XP_001420862         360 dilensetdnftifeerkkrnyddfwkAIPEHEPYRVILAELRDKLYNTREALQRCIADNDVnidMNDETIIRSKDELFA 439  Ostreo...
jgi:MICPUN_104763    339 llheresaehvye--mrkqrnyadfwrSLPMEEPYRVVLAEVRDKLYNTREALQAVIMGKAEaldPADDSIFRDKNQLLE 416  Microm...
1QB4_A               355 PLYACYQSLQACGmgiIANGDLLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYESWSEADKQAFLIREL 434  Escher...
Q2SL23               356 PLMVCYRSLRDCGmevIANGPLLDVIRRAQCFGLQLVRLDIRQDSERHSDVMKEICAYLGIGDYSQWTEEEKQAFLIREL 435  Hahell...
CASKLGSI:MRBBS_2642  353 PLELCYRSLVECGleyIANGPLLDTIRRAHTFGLPLSRLDIRQEAARHAEAVAEIVGYLGLGDYQAWSEVERQAFLVREL 432  Marino...
Q8EK30               354 PLEMLYKSLYDCGmrlIANGLLLDILRRLACFGIHMLRLDIRQDAGRHCDVLAELTRYLGMGDFNHWDETEKQAFLLREL 433  Shewan...
Q87L54               353 PLYACYQSLHECGmgvIADGSLLDTLRRVKAFGVHLVRLDIRQESTRHADVLSELTRYLGIGDYEQWSEQDKIAFLTNEL 432  Vibrio...
Q54JZ3               397 VLQVCYDSLVEVGakeVADGRLLDNIRRLKSFGLTLSKMDIRQESTRHSDVINCVTEYLGLGTYNDWDEPKKQAFLIGEL 476  Dictyo...
XP_006370158         412 PLELCYRSLCSCGdrtIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLEIGSYREWSEERRQEWLLSEL 491  black ...
XP_001760595         408 PLDLCYRSLCETGdkpVADGSLLDFMRQVSCFGLSLVKLDIRQESERHADVMDAITLHLGMGSYKDWSEEQRQEWLISEL 487  Physco...
XP_001420862         440 PLVVCYESLIEVGdaqIANAYLLDVIRQVQCFGLGLVKLDIRQESDRHAEALDAVTRYIGLGSYLEWSEEQKIEFLTREL 519  Ostreo...
jgi:MICPUN_104763    417 PLMACHQSLIEVGdgtVADGSLLDLIRQVNCFGLSLVKLDIRQESDRHADAVDAITRHIGLGSYNDWDEEKKTEWLVSEL 496  Microm...
1QB4_A               435 NSKRPLLPRNWQPSAETREVLDTCQVIAEAPQG---SIAAYVISMAKTPSDVLAVHLLLKEAGIGFA--MPVAPLFETLD 509  Escher...
Q2SL23               436 EGRRPLLPKEWPASAEAREVLDTCRVVAMQPPE---GLASYVISMASDPSDVLTVILLLRESGMRHH--IPIAPLFETLS 510  Hahell...
CASKLGSI:MRBBS_2642  433 KGRRPLIPRNWQPSEAVQEVLATCKVVAEQTPQ---ALGSYVISMASKPSDVLSVILLLREAGMQYP--MAVVPLFETLN 507  Marino...
Q8EK30               434 SNRRPLIPSNWQPSADVAEVLNTCRLIAKHPAK---ALGSYVISMASKPSDVLTVLLLLKETGCTHP--MRVVPLFETLS 508  Shewan...
Q87L54               433 ASKRPLLPRDWEPSEPVKEVLDTCKIIALQPRE---AFGAYVISMARTASDVLAVHLLLQEAGCPYR--MDVCPLFETLD 507  Vibrio...
Q54JZ3               477 ESKRPLIPHDLPCSSEVREVLDTFKVAASLPNG---SLGAYVISMCRNPSDILAVHLLQKAVGNKNP--QRVVPLFETAA 551  Dictyo...
XP_006370158         492 RGKRPLFGPDLPKTEEISDVLDTFHVIAELPAD---NFGAYIISMATAPSDVLAVELLQRECHVKQP--LRVVPLFEKLA 566  black ...
XP_001760595         488 RGKRPLFGSDLPMTEEVKDVLETLRVVADLPSD---CFGAYIISMATAPSDVLAVELLQRECQVPKP--LRVVPLFEKLA 562  Physco...
XP_001420862         520 ESKRPLLPSDLECSDDVREVLDTCKMIAHLQQTcpgALGTYVISMATSASDVLAVVLLQRECGCRKQdlLRVAPLFERLD 599  Ostreo...
jgi:MICPUN_104763    497 KSKRPLVASDLECTDDVREVLDTFKMIAHLQEVcpgSLGTYVISMATVASDVLAVVLLQREMGGKMDqlLRVAPLFERLD 576  Microm...
1QB4_A               510 DLNNANDVMTQLLNIDWYRGLIQGKQMVMIGYSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGG 589  Escher...
Q2SL23               511 DLQGAADSIGRLLDLPWYREYIGGKQEVMIGYSDSAKDAGQMAAAWAQYQAQEALVKVAAKHDVKLTLFHGRGGTVGRGG 590  Hahell...
CASKLGSI:MRBBS_2642  508 DLSGAPQSMTELYQIDWYREYCDGKQEVMIGYSDSSKDAGQMMAAWAQYQAQEALTKVAAEYDMRLTLFHGRGGTVGRGG 587  Marino...
Q8EK30               509 DLNNAAACITDLLDIDWYRGYTKGMQEVMIGYSDSAKDAGVMAAAWAQYRAQEQLVAVCNQAGVKLTLFHGRGGSIGRGG 588  Shewan...
Q87L54               508 DLNNAESVIKQLMSIDLYRGFIQNHQMVMIGYSDSAKDAGVMSAGWAQYHAMESLVKVAEDEGVELTLFHGRGGTVGRGG 587  Vibrio...
Q54JZ3               552 DLDSSPKTMEELFLQQWYLKSINGEQEIMLGYSDSAKDSGRFMSCWELFKAQERLASLTEKFNVKLTLFHGRGGTAARGG 631  Dictyo...
XP_006370158         567 DLEAAPAALVRLFSIDWYRNRINGIQEVMIGYSDSGKDAGRFSAAWQLYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGG 646  black ...
XP_001760595         563 DLQLAAATLSRLFSIDWYLNHINGKQEVMIGYSDSGKDAGRLSAAWQMFTAQEELVKVAKQYGIKLTMFHGRGGTVGRGG 642  Physco...
XP_001420862         600 DLNDAPRVLRQLFSVKWYHDHIAGFQEVMIGYSDSGKDAGRMAAAWALYDGQERVVAAGKEFDVALTLFHGRGGTVGRGG 679  Ostreo...
jgi:MICPUN_104763    577 DLNEGPNQLRRLFSIPWYHELIDGHQEVMIGYSDSGKDAGRMAAAWALYEGQENATKVADEFGVKLTLFHGRGGTVGRGG 656  Microm...
1QB4_A               590 APAHAALLSQPPGSLKG-GLRVTEQGEMIRFKYGLPEITVSSLSLYTGAILEANLLPPPEPKESWRRIMDELSVISCDVY 668  Escher...
Q2SL23               591 GPANRAILSQPPGSVAG-NFRITEQGEMIRFKFGQPKVAKQSFNLYLGAVLEASLVPPPEPEPAWREMMDKLSHLAVNSY 669  Hahell...
CASKLGSI:MRBBS_2642  588 GPANRAILSQPPGSVNG-SFRITEQGEMIRFKFGMPDLAVQSLTLYTTAVIEATLAPPPQPQDSWRETMNWLTERSLKAY 666  Marino...
Q8EK30               589 GPAHKAILSQPPGSVDG-RIRVTEQGEMIRFKFGLPKLAVQSLALYTSAVLEATLLPPPEPKQEWRNCMERIAEESVSAY 667  Shewan...
Q87L54               588 APAHAALLSQPPKSLKG-GLRVTEQGEMIRFKLGLPDVAVNSFNLYASAILEANLLPPPEPKQEWRDLMEVLSEVSCEAY 666  Vibrio...
Q54JZ3               632 GNSHEGIMSQPGGSLKSaSTRVTIQGEMIDSHYGQIGASIRNFELFTTALLKQSLTPPPPPKQRWREIMEQLSITSCKKY 711  Dictyo...
XP_006370158         647 GPTHLAILSQPPDTIHG-SLRVTVQGEVIEKCFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVVATEEY 725  black ...
XP_001760595         643 GPTHLAILSQPPDTVNG-SLRVTIQGEVIEKSFGEEELCFRTLQRFTAATLEHGMHPPFAPKPAWRNLMDDMAGVSTEEY 721  Physco...
XP_001420862         680 GPAHIAMLSQPPGTVNG-SIRVTVQGEVIETDFGEKENCFHTLDLYTASVLEHTLKPPAHPRDEWRRVMDRMSEYSCAHY 758  Ostreo...
jgi:MICPUN_104763    657 GPSHLAILSQPPATING-RLRVTVQGEVIEQNFGEHENCFHTLDLYTAATLEHSLAPPLAPSDEWRGAMATMSEVSCERY 735  Microm...
1QB4_A               669 RGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRR--PTGGVESLRAIPWIFAWTQNRLMLPAWLGAGTALQKV--VED 744  Escher...
Q2SL23               670 REVVRERPGFVEYFRSATPEQELGKLALGSRPARRK--ASGGVESLRAIPWIFAWTQMRLMLPAWLGSDTALQTA--VDD 745  Hahell...
CASKLGSI:MRBBS_2642  667 RDVVRDDPQFVLYFRQVTPEQALGKLALGSRPARRK--AGGGVESLRAIPWIFAWTQMRLMLPAWLGSDVALEAA--AED 742  Marino...
Q8EK30               668 RGIVREEPDFVAYFRAATPEVELGKLPLGSRPAKRR--VDGGIESLRAIPWIFAWSQNRLMLPAWLGAGEALQAA--CQR 743  Shewan...
Q87L54               667 RGVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRN--PNGGVESLRAIPWIFSWSQNRLVLPAWLGAGEAIQYS--VDK 742  Vibrio...
Q54JZ3               712 RSVVRENPSFIQYFRTSTVQPEMVYLNIGSRPAKRIaaKSFGLEHLRAIPWVFSFSQNRLNLPVWLGIEDAILEA--KTK 789  Dictyo...
XP_006370158         726 RSIVFKEPRFVEYFRLATPEMEYGRMNIGSRPSKRK--PSGGIESLRAIPWIFAWTQTRFHLPVWLGFGAAFKHIiqKDI 803  black ...
XP_001760595         722 RSVVMKNPTFVPYFRAATPEQEYGRMNIGSRPAKRK--PSGGIESLRAIPWIFAWTQTRFHLPVWLGVGGALKYVlqVDP 799  Physco...
XP_001420862         759 RKTVFETPDFVGYFAQATPGAELGSLNIGSRPAKRK--PSAGVTALRAIPWIFAWTQSRFHLPVWLGISTSFRRL--IDE 834  Ostreo...
jgi:MICPUN_104763    736 REIVFKTPEFNPYFLQATPGQELGALNIGSRPAKRK--SNAGVTALRAIPWIFAWTQSRFHLPVWLGIAEGFQRV--KEQ 811  Microm...
1QB4_A               745 GKQSELEAMCRDWPFFSTRLGMLEMVFAKADLWLAEYYDQRLV-DKALWPLGKELRNLQEEDIKVVLAIANDSHLMADLP 823  Escher...
Q2SL23               746 GGADTLKAMLTGWPFFETHVDMLEMVLSKVDPEIARFYEERLV-KPELHPLGDELRRRAGCAVRLINELKGQDELLLDNP 824  Hahell...
CASKLGSI:MRBBS_2642  743 QRIDQLREMMAGWPFFRTYIDMLEMVLAKADLRIASYYEQTLVdDPALRALGENLRQRLSRCIHRVLELKQQDHLLAAEP 822  Marino...
Q8EK30               744 GEIGLLQDMEREWPFFSTRISMLEMVYAKAEPNLARYYETCLV-STNLHHLGETLRQRLDLGIKVVLELTKSDTLMAHTP 822  Shewan...
Q87L54               743 GHQALLEEMCREWPFFSTRLGMLEMVYTKCNMEISRYYDQRLV-EPQLQPLGDRLREQLQRDIKSVLNVENNENLMQSDP 821  Vibrio...
Q54JZ3               790 GWGSDINEMYKEWPFFSSTIDLVEMVLLKTDPQISLRYNQMLV-PAQVQPLGIEMIDELTKTTNAILELTKHKTLQQDNK 868  Dictyo...
XP_006370158         804 RNLHMLQEMYNAWPFFRVTIDLVEMVFAKGDPGIAALNDKLLV-SEDLWAFGEKLRADYEETKGLLLQIAGHKDLLEGDP 882  black ...
XP_001760595         800 KNMGILRKMYDQWPFFRVTLDLIEMVFAKGDPRIAALYDRLLV-KDDHKSFGEKLRNNYNETRELVLKVAGHEDVLEGNP 878  Physco...
XP_001420862         835 GELETLRDMYKSWPFFEVTIDLVEMVLAKADPVVVAYYERALV-DPKLHDFGASLRGELQESIDCILAVSEHIGLLAKPE 913  Ostreo...
jgi:MICPUN_104763    812 GKLETLREMYRTWPFFRVTMDLIEMVLAKADPTVARLYEKELV-EEQYHAFGEQLRKALRSTVDIVLEVTEHPDLLTSQT 890  Microm...
1QB4_A               824 W------------IAESIQLRNIYTDPLNVLQAELLHRSRQAEKEGQE---------------------------PDPRV 864  Escher...
Q2SL23               825 V------------FMHSLQVRNPYTDPLHFLQVELLVRDRAEGET------------------------------NKETV 862  Hahell...
CASKLGSI:MRBBS_2642  823 V------------FAHSMNVRNPYTDPLHYLQAELLRRERQSEGKGGDdgdr--------------------ngkVPELV 870  Marino...
Q8EK30               823 W------------NRESVKLRNPYIDPLNFLQTELLARTRKETSETP----------------------------ASEHV 862  Shewan...
Q87L54               822 W------------GQESIRLRNIYVEPLNMLQAELLYRTRQTEE-------------------------------ASANL 858  Vibrio...
Q54JZ3               869 I------------LQHFVSIRRTFMDPINYIQVETLKRLRSTQKPDGTnd------------------------dADPIL 912  Dictyo...
XP_006370158         883 Y------------LKQRLRLRDSYITTLNVCQAYTLKRIRDPNYNVTTrphiskeimessn-padelvklnptseYGPGL 949  black ...
XP_001760595         879 T------------LKQRLRLREQYITPLNVQQAYTLKKMRDFRAQLGVheenanqeelhngkvsselvmlntttqYPPGL 946  Physco...
XP_001420862         914 KveaneavqvhkkLAHKLHKRSLYITPLNVCQVRYLIAARALENEEDGdklsmqkvkit-----llegypfqdynYKGAV 988  Ostreo...
jgi:MICPUN_104763    891 Tnggqg---sintLKDKLAMRSIYLTPLNIIQVENLKRLRDIEDGKVDtkgyvpvmpwak----qmlslhvskdyYHAAV 963  Microm...
1QB4_A               865 EQALMVTIAGIAAGMRNTG 883  Escherichia coli
Q2SL23               863 EKALKVTMAGVAAGMRNTG 881  Hahella chejuensis KCTC 2396
CASKLGSI:MRBBS_2642  871 ERALKVTMAGISAGMRNTG 889  Marinobacter sp. BSs20148
Q8EK30               863 QLALMLTIAGVAAGMRNTG 881  Shewanella oneidensis MR-1
Q87L54               859 EEALMVTIAGIAAGMRNTG 877  Vibrio parahaemolyticus RIMD 2210633
Q54JZ3               913 IDTLIITFNGISAGMKNTG 931  Dictyostelium discoideum AX4
XP_006370158         950 EDTLILTMKGIAAGMQNTG 968  black cottonwood
XP_001760595         947 EDTLILTMKGIAAGMQNTG 965  Physcomitrella patens
XP_001420862         989 NDVLKITMKGIAAGMQNTG 1007 Ostreococcus lucimarinus CCE9901
jgi:MICPUN_104763    964 SDTLIITMKGIAAGMQNTG 982  Micromonas commoda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap