6AHY


Conserved Protein Domain Family
wnt

?
pfam00110: wnt 
Click on image for an interactive view with Cn3D
wnt family
Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.
Statistics
?
PSSM-Id: 425469
Aligned: 185 rows
Threshold Bit Score: 260.554
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6AHY_B         11 SIPGLVPXQLRFCRNYIEIMPSVAEGVXLGIQECQHQFRGRRWNCTTIDDSlaIFGP--VLDXa-TRESAFVHAIASAGV 87  
XP_002407191   50 QQHRKEARLRRFCSVDPGLVQAIVHGTRLTVDSCQSLFQWEPWQCDLLQDKrr-----hLLKKv-YRETALVYALAAAGL 123 black-legged tick
10_pfamImport   1 DSFRLTTSQRRKCKRDPGMPQVLTEATHIAAAECQHQFRDERWNC-SLGTSri-----hILNKg-NRETAFLFSISSAGL 73 
XP_002598627  124 ESFKLKRKQRRMCKRDAGVAETLVEAMHMSARECQHQFHNERWNC-TLGKTrl-----nMLKRg-FKETAFLYAISSSGL 196 Florida lancelet
XP_012398898   62 DRLKLEKKQRRMCRRDPGVAETLMEAISMSALECQYQFRFERWNC-TLEGR--YRAS--LLKRg-FKETAFLYAISSAGL 135 Tasmanian devil
XP_005809495   60 DRLKLEKKQRRMCRRDPGVADTLREAIIMSALECQHQFRFERWNC-TLEGR--HRAN--ILKRg-FKETAFLYAISSAGL 133 southern platy...
XP_005998639   59 ELLKVSRKQKRLCRREPGLAETLRDSVRLSLLECQYQFRNERWNCS-------LDGRasLLKRg-FKETAFLYAVSSAAL 130 coelacanth
ACI95255       58 EQMTLTRRQKRLCRREPGLAETLRESVRLSLLECRYQFRNERWNC-SMDGR----GS--LLKRg-FKETAFLLAVSSAAL 129 zebrafish
XP_003768486  124 DLLKLSRKQKQLCRREPGLAETLYDAVHLGVLECQAQFRHERWNCS-------LEGRtaLLKRg-FKETAFLYAVSSAAL 195 Tasmanian devil
1_pfamImport    1 DLLKLSRKQKRLCRREPGLAETLRDAIRLGIMECQFQFRSERWNC-SLEGRtsLLKR--ELDEnsLRETAFLYAVSSAAL 77 
6AHY_B         88 AFAVTRSCAEGTSTI-CGCDSHHXGPPGEG-----WXWGGCSEDADFGVLVSREFADARENR-P-DARSAMNXHNNEAGR 159 
XP_002407191  124 THSVARGCSSGRLSSrCSCNESGSRTLSATesdqnWKWGGCGDNYSFSAKFSRKLLARNKSRrPrTLRRPVDNHNLVVGI 203 black-legged tick
10_pfamImport  74 THAVARACANGHLKR-CSCDDSYDSHVTDGs----WRWDGCGDNVHYAAKFVRRFLKSRST--SrDIRAEVDKHNSDLGI 146
XP_002598627  197 THALGRACSSGKLER-CTCDESFNDIDNREt----WLWGGCGDNLKYSRKFARQFLSMNKAE-EqDLRAAVDRHNTNLGI 270 Florida lancelet
XP_012398898  136 THALAKACSAGRLER-CTCDEAPDLENREA-----WQWGGCGDNLKYSNKFVKEFLGKKSSk---DLRARVDFHNNLVGM 206 Tasmanian devil
XP_005809495  134 THALAKACSAGRMER-CTCDEAPDLENRKA-----WQWGGCGDNLKYANKFVKEFLGKRSNk---DLRARVDTHNTNVGM 204 southern platy...
XP_005998639  131 THSLAKACSSGRMER-CTCDDSPDLENREA-----WQWGVCGDNLKYSTKFLKNFLGQRRI--SkDLRARVDMHNTNVGV 202 coelacanth
ACI95255      130 SHALAKACSSGRMER-CTCDDSPGLQHREA-----WQWGVCGDNLKYSTKFLKKFLGQKRV--SkDLRAQIDAHNINVGI 201 zebrafish
XP_003768486  196 THALARACSAGRMER-CTCDDSPDLENRQA-----WQWGVCGDNLKYSTKFLSNFLGPKKG--SkDLRARMDAHNTNMGI 267 Tasmanian devil
1_pfamImport   78 THSLARACSAGRMER-CTCDDSPDLENRKA-----WQWGVCGDNLKYSTKFLKKFLGQKRI--GkDLRAKVDIHNTNVGI 149
6AHY_B        160 TTILDHMHLXCXCHGLSGSCEVXTCWWAQPDFRAIGDFLXDXYDSA-SEmvVe-------------XHRESRGwv---eT 222 
XP_002407191  204 RVLRHGIRRVCKCHGLSGSCSAKTCWEELAHFPDVAKALKRKYSKAiMAq-VenkpdfastevvskLKKTLLTrttqkpK 282 black-legged tick
10_pfamImport 147 RVVKSNVKVTCKCHGVSGSCTTKTCWRKMAPFYEIGRKIKRAYDKA-VK--Vg-------------SINNSNGrar-liR 209
XP_002598627  271 RVVRSRVKTTCKCHGVSGSCSVQTCWRQLAPFHEIGDVLKNKYEKA-MK--Vv------------sMTNGAGEr----aQ 331 Florida lancelet
XP_012398898  207 KVIKAGVETTCKCHGVSGSCTVRTCWRQLSPFHEVGKQLKQKYESS-LK--Vgst---------tnEATGEAG------D 268 Tasmanian devil
XP_005809495  205 KVIKAGVETTCKCHGVSGSCTVQTCWRQLLPFHEIGNRLKLRYETS-VK--Vgs----------stNEATGEG------D 265 southern platy...
XP_005998639  203 KAVKSGLKTTCKCHGVSGSCAVRTCWKQLSPFHETGKLLKHKYETA-IK--Vf------------sVTNDATGe----aE 263 coelacanth
ACI95255      202 RAVKSGLKTTCKCHGVSGSCAVRTCWKQLSPFQDTGHLLKYRYDTA-VR--Vh------------sVTNSATGe----tE 262 zebrafish
XP_003768486  268 KAVRNGLKTTCKCHGVSGSCAVRTCWKQLSPFRETGQLLKLRYDSA-VK--Vs------------sTSNEALGr----lE 328 Tasmanian devil
1_pfamImport  150 KAVKNGLKTTCKCHGVSGSCAVRTCWKQLSPFHEVGRLLKLRYDDA-VK--Vf------------sTTNDAVGh----sE 210
6AHY_B        223 LRA--XYSLF------XP----------PTERDLVYYENSPNFCEPNPETGSFGTRDRTCNVTSHgidgCDLLCCGRGHN 284 
XP_002407191  283 WLR---AVTAe----lQR----------LGRDRLVYLEESPSFCERNVLTG--GMSQRRCRDHAH----CEQVCCGRGHR 339 black-legged tick
10_pfamImport 210 LRRsrLRHRKls---gEI----------PRNKELVYLEKSPTYCRKSRY--SKGTKGRVCKDERS----CDKVCCGRGYT 270
XP_002598627  332 LMN---EPVGne--apKG----------PKNNDMVFVDDSPSYCKKGKY--SYGTRGRICDKEKN----CDSICCGRGHN 390 Florida lancelet
XP_012398898  269 IPP----PRR------ALgssgpgtdplPRTPDLVHLDDSPSFCLASRF--SPGTAGRKCYKDKN----CESMCCGRGHN 332 Tasmanian devil
XP_005809495  266 ISTgrNQQQQ------QQhslpglsdqiPRTMDLLHIEDSPSFCKPSKY--SAGTAARKCYKDQN----CDAICCGRGHN 333 southern platy...
XP_005998639  264 LVS---PKKHshslkhHS----------PRSTDLVYMEDSPSYCRTGKY--SPGTAGRICSKETN----CDSMCCGRGYN 324 coelacanth
ACI95255      263 LAG---PRRHsi--tlPr----------PRPTELVFLEESPSFCRPSRY--SPGTAGRPCSKDTS----CSSLCCGRGYN 321 zebrafish
XP_003768486  329 LWA---PPRPgh--pvKGt--------aPRPGDLVYIDDSPSFCRPSKY--SPGTAGRTCSREAS----CDSLCCGRGHN 389 Tasmanian devil
1_pfamImport  211 LAS---PQRHsh--stKHha-------sPRATDLVYVEDSPSFCRPSKY--SLGTAGRTCSREGN----CDSMCCGRGYN 272
6AHY_B        285 TRTEXRXEXCHCIFHWCCYVSCQECIRIYDVHTC 318 
XP_002407191  340 SFSETVQERCHCRVVWCCQLECKTCTVLKYSHSC 373 black-legged tick
10_pfamImport 271 THVRLVRRSCQCEVKWCCAVHCNTCSERKKIHTC 304
XP_002598627  391 TQSLVIKRPCQCQVKWCCYVECKECNTRENIYMC 424 Florida lancelet
XP_012398898  333 TQSRVVTRPCQCQVRWCCYVECKQCTQREEVYTC 366 Tasmanian devil
XP_005809495  334 TQSREVTGPCQCQVRWCCYVECKQCTQREEVYTC 367 southern platyfish
XP_005998639  325 TQSRVVKFSCHCQVQWCCYVECQQCMQEEEVYTC 358 coelacanth
ACI95255      322 TALRLTTLSCHCQVRWCCHVECQTCLREEEVYTC 355 zebrafish
XP_003768486  390 TQSRLVAFSCHCHVQWCCYVECQQCVQEELAYTC 423 Tasmanian devil
1_pfamImport  273 TQSRLVTFSCHCQVQWCCYVECQQCMQEEVVYSC 306
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap