Conserved Protein Domain Family
gamma_NF038106

?
NF038106: gamma_NF038106 
PA4642 family protein
Member of this family are small (about 95 amino acids), uncharacterized, and apparently restricted to the Gammaproteobacteria. Members include PA4642 from Pseudomonas aeruginosa PAO1.
Statistics
?
PSSM-Id: 411685
Aligned: 43 rows
Threshold Bit Score: 134.98
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_001218557   2 ALSQPATFNEEWSDERVFAYLNQLPPN-GVNADFHVLYHAFKHMRPNDYDRLLTKFVADGRDINATNPEGERIHDVIAKF 80  Acinetobacter b...
WP_004750632   2 ALSQPATFNEEWSDERVFAYLNHLPPE-GNSADFHVLYNAYKHMRPHDFERLLTQFTADGRDVNATNPQGQRIHDVIAQF 80  unclassified Ac...
WP_016657268   2 ALSQPATFNEEWSDERVFAYLTQLPPE-GEDADFHVLYHAYKHMRTGDYQRLLQRFVADGRNVQATNKQGQTIHQVIAQF 80  Acinetobacter r...
WP_011394039   3 GPSQPKVVDEEWSDERVQGFLALLPRD-ETDPDYHVLRQAYEYMLARDYARFVAYFAEAGRNINALSPEGETMLDRVAEH 81  Hahella chejuensis
WP_020409184   3 GPSQPKVIGEDWSDDRVKGFLDLKPYD-NRDPDYHVLRESYEYMLAGDYARLVKFFVDAGRNINALGPDGQTMLDRVSEH 81  Hahella ganghwe...
WP_011783631   3 GPDKPKVIGEEWSDERVKSYLDLTPWDrSINADYFVLSRAYESMRAEDFERFISFFVEAGRDLNAEDEHGATILDRVALH 82  Marinobacter
WP_008940101   3 GPDKPKVIGEEWSDERVKSFLAIEPYDrSVNVDFEVLLKAYRAMRAEDFERFIGFFVEAGRDLNAPDESGRTLLDQISEH 82  Marinobacter sa...
WP_007152958   3 GPDKPKVIGEEWSDERVKSFLAITPYDsNINPDFNALIKAYQAMIAEDFDRFVGFFVEAGRDLNAVDENGETILDLVSRH 82  Marinobacter
WP_004579589   3 GPDKPKVIGEEWSDERVKSFLFITPYDsKLNPDYQVLLKAYQAMRASDFERFLGFFTEAGRDLNATNELGQTILDHISEH 82  Marinobacter na...
WP_007231476   4 KKDKEKVLGEVFDDERVKSFLEYEAPE-GVSTDFHLLEKTYRGMNIDNFVTFLGFFKEAGHDLDATNPDGKTMVEIAAEH 82  gamma proteobac...
WP_001218557  81 PRqSAPFLEVLAKFA 95  Acinetobacter baumannii
WP_004750632  81 PRhSTEFLNVLAKFA 95  unclassified Acinetobacter
WP_016657268  81 PRhSQDYLDVLKQFA 95  Acinetobacter rudis
WP_011394039  82 AR-GAEYAQILRDAG 95  Hahella chejuensis
WP_020409184  82 AK-GQEYAVLLKEAG 95  Hahella ganghwensis
WP_011783631  83 RR-SAEYARVLENAG 96  Marinobacter
WP_008940101  83 RR-GGAYAEALERAG 96  Marinobacter santoriniensis
WP_007152958  83 RR-STAYAETLRKAG 96  Marinobacter
WP_004579589  83 RR-SVDYIAALQTFG 96  Marinobacter nanhaiticus
WP_007231476  83 GH-GVAYVDALKAAG 96  gamma proteobacterium HTCC2207
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap