Conserved Protein Domain Family
GyrA_w_intein

?
NF038098: GyrA_w_intein 
intein-containing DNA gyrase subunit A
Statistics
?
PSSM-Id: 411680
Aligned: 33 rows
Threshold Bit Score: 1893.29
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_140188131   15 RIEPVDIQQEMQSSYIDYAMSVIVGRALPDVRDGLKPVHRRVLYAMYDNGFRPDRGYVKSARAVAETMGNYHPHGDASIY 94   Rhodococcus r...
WP_156755406   11 RIEPVDIQQEMQSSYIDYAMSVIVSRALPDVRDGLKPVHRRVLYSMFDTGLRPDRSYVKCSRVVGDVMGNYHPHGDSSIY 90   Actinokineosp...
WP_035303300   11 RIEPVDIQQEMQNSYIDYAMSVIVSRALPDVRDGLKPVHRRVLYSMFDTGLRPDRSYVKCSRVVGDVMGNYHPHGDSSIY 90   Actinokineosp...
WP_092786669   11 RIEPRDIQQEMQSSYIDYAMSVIVSRALPDVRDGLKPVHRRVLYSMFDTGLRPDRSYVKCSRVVGDVMGNYHPHGDSSIY 90   Actinokineosp...
WP_133904066   14 RTEPVDIQHEMQRSYIDYAMSVIVSRALPDVRDGLKPVHRRVLYSMYDTGLRPERSHVKCSRIVGDVMGNYHPHGDSAIY 93   Actinophytoco...
WP_083668925   13 RTEPRDIQQEMQNSYIDYAMSVIVGRALPDVRDGLKPVHVRVLYSMFDSGFRPERSYNKCARVVGDVMGNYHPHGDSAIY 92   Saccharothrix...
WP_061981624   13 RIEPVDIQQEMQRSYIDYAMSVIVSRALPDVRDGLKPVHRRVLYSMFDSGFRPDRGYNKCSRVVGDVMGNYHPHGDSAIY 92   Amycolatopsis...
WP_091668925   11 RIEPVDIQQEMQRSYIDYAMSVIVARALPDVRDGLKPVHRRVLYSMFDNNFRPDRGYNKCSRVVGDVMGNYHPHGDSAIY 90   Amycolatopsis...
WP_034267730   11 RIEPVDIQQEMQRSYIDYAMSVIVSRALPDVRDGLKPVHRRVLYSMFDTGLRPDRSYTKCSRVVGDVMGNYHPHGDSAIY 90   Haloechinothr...
WP_019810999   12 RVEPVDIQQEMQNSYIDYAMSVIVSRALPDVRDGLKPVHRRVLYSMYDSGFRPDRGYNKCSRVVGDVMGNYHPHGDSAIY 91   Saccharomonos...
WP_140188131   95 DTLVRLAQPWSMRYPLVDGQGNFGSRGNDGAAAMRYCVPGDTLVRMPHGqSIRISEILPGVEPDSDNEIDLKVLDRHGNP 174  Rhodococcus r...
WP_156755406   91 DTLVRLAQPWSMRYPLVDGQGNFGSPGNDPAAAMRYCVVADTRVKLADGsTPRIGDLVPDAAPNSDNELDIKVLDRNGDP 170  Actinokineosp...
WP_035303300   91 DTLVRLAQPWSMRYPLVDGQGNFGSPGNDPAAAMRYCIDAETRVKMHDGsSVRIGDIVPDAQPNTDNVIDLKVADRDGNP 170  Actinokineosp...
WP_092786669   91 DTLVRLAQPWSMRYPLVDGQGNFGSPGNDPAAAMRYCLDAGTRVRMHDGsSMRIGDIVPDALPNSDNVIDLKVLDRNGNP 170  Actinokineosp...
WP_133904066   94 DALVRLAQPWSMRYPLIDGQGNFGSPGNDPQAAMRYCVDADARVKLADGsSVRIADIVPGAAPNTDNPIDLKVLDRNGDP 173  Actinophytoco...
WP_083668925   93 DALVRLAQPWAMRYPLIDGQGNFGSQGNDPAAAMRYCSVPETRIRLADGsTPRIGDIVPDAKPNSDNPIDLKVLDRNGNP 172  Saccharothrix...
WP_061981624   93 DALVRLAQPWSLRYPLIDGQGNFGSPGNDPAAAMRYCVTRDTRIKVADGsTVRIGDIVPDAKPNSDNPIDLKVMDRNGDP 172  Amycolatopsis...
WP_091668925   91 DALVRLAQPWAMRYPLIDGQGNFGSPGNDPAAAMRYCVAADTRVKLADGsTTRIADIVPDAKPNSDNPVDLKVMGRHGDP 170  Amycolatopsis...
WP_034267730   91 DALVRLAQSWSMRYRLVDGQGNFGSPGNDPAAAMRYCVTGDARVKLADGaTARIDEIVPDAAPNSDNDVDLKVVGRNGDP 170  Haloechinothr...
WP_019810999   92 DALVRLAQGWSMRYPLIDGQGNFGSPGNDPAAAMRYCVTGDTRVKLADGaTVAIGDLVPDARPNSDHPVDVKLLDRNGDP 171  Saccharomonos...
WP_140188131  175 VMAEMLFHSGTHRTYTLSTVEGYEMRGTANHPVLCLVDVAGVPTLLWKLLEEIRSGDRVVLQRVPsAEEHGRhNEYEAAA 254  Rhodococcus r...
WP_156755406  171 VRADALLHSGDQPTLTLRTAEGFELTGTPNHPVLALVDLGGVPTLLWKLLEEVQPGDRVAMQRVPgDDVDTP-TAREQAN 249  Actinokineosp...
WP_035303300  171 VRADRLFHSGEHPTLKLTTREGYELTGTHNHPVLCLVSVAGVPTLLWKLLEEIQPGDRVVMQRTPmEEVGLP-TAGECAA 249  Actinokineosp...
WP_092786669  171 VRADRLFHSGEHPTLRLTTREGFELTGTHNHPVLCLVSVLGVPTLLWKLLEEIQPGDRVVMQRTPaEEAGLP-PVEDYAA 249  Actinokineosp...
WP_133904066  174 VGATMLFHSGEHSSLKLTTNEGFSLTGTHNHPVLCLVNVLGVPTLLWKLLEEIAPGDRVVLQRAPyDEADIP-SAKDFAA 252  Actinophytoco...
WP_083668925  173 VRADMLFHSGEHPTLKLRTRNGYELTGTHNHPVLCLVNVLGVPTLLWKLLEEIQPGDRVVLQRTPqENGDLP-EIGQYSA 251  Saccharothrix...
WP_061981624  173 VRADMLFHSGDHPTLKLATREGYELTGTHNHPVLCLVSVLGVPTLMWKLLEEVKPGDRVVLQRTDaPTDGVT-EVRKWVE 251  Amycolatopsis...
WP_091668925  171 VRADALFHSGEHPTLQLNTREGFQLTGTHNHPVLCLVNVLGVPTLLWKLLEEIRPGDKVAMQRTEaPLEPVT-EVRSWVE 249  Amycolatopsis...
WP_034267730  171 VRADALFHSGDHPTLRLTTREGYELTGTYNHPVLCLVNVLGVPTLLWKLLEEIEPGDRVVMQRTEaADEAVT-EVRSWVE 249  Haloechinothr...
WP_019810999  172 VRADMLFHSGEHPTLRMTTREGFELTGTHNHPVLCLSRVLGVPTLVWKLLSEIEPGEKVVLQRTEpPAGSDT-DPRHLDE 250  Saccharomonos...
WP_140188131  255 ALLLGAFVSEGFVSENRAGFNNLDRDFFDRVVDAFDRVVGGRRYVYSRVIKSSSTLHELDVQdLTMLRRSVLAGVIGQRS 334  Rhodococcus r...
WP_156755406  250 ALGAASRFVKDPTTA----------------------------------------------------------------- 264  Actinokineosp...
WP_035303300  250 AIDAAKQLVDMTSEP---------------------------------------------------VIVGPDGSPESALA 278  Actinokineosp...
WP_092786669  250 AILAGAFVSEGFASPTRAGFNNTDKAYFDYTVAAYDLVVGGRRHVSSRTIASGSVLHELDIQdMTAFMAGPLAELVGTRS 329  Actinokineosp...
WP_133904066  253 ATLAGAFVSEGFVAKKRAGFNNIDEAFFSLVREAYDVAVGGPRYVSTRTIKSGSPLHELDVHdLTALRKSVLAPMVGQRS 332  Actinophytoco...
WP_083668925  252 AILAGAFVSEGFVSENRAGFNNIDAEYFQRVVEAYDDAVGGPRYVSSRTIKSGSVLHELDVQdLTQLRETMLGTMVGQRS 331  Saccharothrix...
WP_061981624  252 GLLAGAFVAEGFVSEERAGFNNVDEAFFDYVRDAYDEVVGGRRYVSRREIASGSVLHEMDIQdLATLRKSVLGEMVGHRS 331  Amycolatopsis...
WP_091668925  250 ALLAGAFVAEGFFSDNRAGFNNIDEDFFKYVLDCYDHVVGGRRYVSQRRIASGSMLHEFDVHdLSALRASVLAELEGQRS 329  Amycolatopsis...
WP_034267730  250 ALLAGAFVAEGFVSEDRAGFNNVDEDFFRYIVDVYDGVVGGPRYTSTRRIASGSVIHELDIHdLTALRRSVLGGLIGQRS 329  Haloechinothr...
WP_019810999  251 ARVAGASVGE---------------------------------------------------------------------- 260  Saccharomonos...
WP_140188131  335 DRKSVPDFIWESPTALKRIFLGALFEGDGSCSSLPRNTVQVSYSTRSLQLAKDVQQLLLEFGVVSRRYRHATGEYKVAVT 414  Rhodococcus r...
WP_156755406  265 --DRVPEQVWAGGPVLKRVFLRVLLTAGASVFADDG-TVRLSYSAPSAGLVSDVQRMLLEFGVLARLT-ATEGVPALVVV 340  Actinokineosp...
WP_035303300  279 PAPLVPEFIWQGGSALKRVFLRSLFDESGTFSGS---SHEIAYPTHSTALAHEVQQLLLEFGVVSKLVGYDDGEIKVVVT 355  Actinokineosp...
WP_092786669  330 AGKHVPEFVWQGGSTIKRAFLSSLFTGDGSCSALPRNTVQISYSTRSTRLASEVQQLLLEFGVVSRLVRYGNGEIKVVIT 409  Actinokineosp...
WP_133904066  333 ADKRVPEFVWRSGIAIKRAFLRALFTGDGSASALPRNTVQVSYSTMSTQLAREVQQLLLEFGVVGRQTRHQGGEIKVVMT 412  Actinophytoco...
WP_083668925  332 AAKRVPDFVWASGEVVKRAFLSSLFTGDGSASALPRNSVQVSYSTRSEQLAREVQQLLLEFGVVSTLVNYEDGEIKVVST 411  Saccharothrix...
WP_061981624  332 ADKRVPEFVWASGRTVKQAFLVGLFTGDGSCSVLPRDTVQISYATISKQLAVDVQQLLLEFGIVSRLTSYENGEYKVYIG 411  Amycolatopsis...
WP_091668925  330 AQKRVPGFVWSSGSTIKRAFLIGLFTGDGSASALPRSTVQVSYSSYSDRLAREVQQLLLEFGVVGKLVHYEDGEHKVVIS 409  Amycolatopsis...
WP_034267730  330 AQKRVPDFVWAASKTIKRAFLVGLFTGDGSCSALPRNSVQISYSTYSEQLSQDVHQLLLEFGIVAKLVRYESGERKLVIT 409  Haloechinothr...
WP_019810999  261 ---RVPEFVHTGGPELKRTFLAALFTGDGSVSGLPRNSVQVSYSTYSARLAREVQQLLLEFGVVAKQVRYDSGEYKVVIT 337  Saccharomonos...
WP_140188131  415 NRRDARLFAERIGFVGCKQRKLEQVLAAAESSspaaaARSMSTDYVPGLAAFLRTHGATDPANVDWLRRHNVDRIERWEH 494  Rhodococcus r...
WP_156755406  341 GHRDVSLLAARVGLRSVAHDELLHLLAEAPVD-----EP----------------------------------------- 374  Actinokineosp...
WP_035303300  356 NRRDARLFAANVGFLQAKQDQLEAILATIPTE-----SRSMSSDHVPFVGEYIRANGAVRWTERDWLRRHNVDRIERWET 430  Actinokineosp...
WP_092786669  410 NRRDARLFATNVGFLQAKQDKLVAILDGIPVE-----SRAMSSDHVPFVGEYIRANGAARWTERDWLRRHNVDRVERWEH 484  Actinokineosp...
WP_133904066  413 NRRDARIFADRVGFIGAKDDELRAMLDAQPIT-----SSALSSDHVPFVADFIRANGARRWTERNWLALHNVDRVERWED 487  Actinophytoco...
WP_083668925  412 NRRDARLFARNVGFLGTKQDKLNAILDAVPLE-----SRAMSSDHVPFVGDYIRAHGATRWTERDWLRRHNVDRVERWER 486  Saccharothrix...
WP_061981624  412 NRRDARLFATRIGFHSAKQQKLEAILDGIPVD-----SRAMSSDHVPFVGEYIRANGASRWTEQDWLRRHNVDRIARWET 486  Amycolatopsis...
WP_091668925  410 NRRDARLFSTRIGFHGAKQVTLESILSALPAD-----SRSMSSDHVPFVGEYIRAQGADRWTERDWLRRHNVDRIARWEL 484  Amycolatopsis...
WP_034267730  410 NRRDARLFATRIGFHSAKQQKLVAILDGLPTE-----STSKSSDHVPFVADYIREHGATRWTERDWLRRHNVDRIERWES 484  Haloechinothr...
WP_019810999  338 NRRDARLFATRIGFDGTKQDKLETVLAEIPHD-----SRSLSSDHVPFVGEYIRGHGARWWTERDWLRRHNVDRVARWET 412  Saccharomonos...
WP_140188131  495 GGDEIASHITEPDARAIAEELTDGRFYYAEVAFVAEGDVEPVYSLRVDTDDHAFVTNGFVSHNTECRLTPLAMEMLREID 574  Rhodococcus r...
WP_156755406  375 --VDPLAGIEDPEARAAAAPLADGRFHYAEVTAVTDAGVQPVFSLRVDTEDHAYVTDGFVSHNTEARLMPLAMEMLRDIG 452  Actinokineosp...
WP_035303300  431 NRDEIVERITQPGVLDVVEPLVDGRFYYAQVKSIADAGVRAVYSIRVDTDDHAFVTDGFVSHNTESRLMPLAMEMLRDIG 510  Actinokineosp...
WP_092786669  485 NRGEIVERITEPGVLDVVEPLVDGRFYYAQVESIVDAGVRPVYSIRVDTDDHAFISDGFVSHNTESRLTPLAMEMLRDIG 564  Actinokineosp...
WP_133904066  488 WRHEIVERITEPGVLDVVEPLVDGRFYYAEVKSVVDAGVRPVYSLRVDTDDHAFVTDGFVSHNTEARMTPLAMAMLQDIT 567  Actinophytoco...
WP_083668925  487 DYDEIAARITNREVLDVVEPLVDGRFYYASVESVTDAGVRPVFSLRVDTEDHAFITDGFVSHNTECRLTPLAMQMLADIE 566  Saccharothrix...
WP_061981624  487 RRDEIAEHITDPEVLTVVEPLVDGRFYYAEVKSITDAGVRPVYSIRVDTDEHAFITDGFVSHNTESRLAHLAMHMLQDIE 566  Amycolatopsis...
WP_091668925  485 RREEITERITNREVLDVVEPLVDGRFYFAEVRDVTDAGPQAVYSLRVDTEDHAFVTDGFVSHNTEARLDPLAMQMLADIE 564  Amycolatopsis...
WP_034267730  485 RRDEITEHITNPDVLDVVEPLVDGRYYYAEVSSVTDAGVQPVYSLRVDSDDHAFITNGFVSHNTEARLTPLAMEMLADIE 564  Haloechinothr...
WP_019810999  413 RRDEIAARITEPDVLDVVEPLVDGRYYYAEVASVSDAGVRSVYSVRVDSDDHAFVTDGFVSHNTESRLDPLAMDMLRDIE 492  Saccharomonos...
WP_140188131  575 HETVDFQPNYDGRTLEPVVLPSRIPNLLINGSGGIAVGMATNIPPHNLREVADAIYWALENFEADEEATLAAVMERIKGP 654  Rhodococcus r...
WP_156755406  453 EDTVDFAPNYDGKTEEPLVLPARIPNLLVNGGSGIAVGMATNIPPHNLREVADGVIWALENPDADDDLLLAELLKRVKGP 532  Actinokineosp...
WP_035303300  511 EDTVDFGPNYDGKTEEPSVLPSRIPNLLVNGGSGIAVGMATNIPPHNLREVADGVVWALDNPDASDEELLAALLTRVKGP 590  Actinokineosp...
WP_092786669  565 EDTVDFVPNYDGKTEEPKVLPSRIPNLLVNGGSGIAVGMATNIPPHNLREVADGVVWALDNPEANDDELLAALLLRIKGP 644  Actinokineosp...
WP_133904066  568 EETVDFADNYDGKTQEPVVLPSRIPNLLVNGSNGIAVGMATNIPPHNLREVASGVVWALENWEASDDETLAAMMTRIKGP 647  Actinophytoco...
WP_083668925  567 EDTVDFRDNYDGRIQEPTVLPSRVPNLLINGSSGIAVGMATNIPPHNLREVADGVVWALDNPDAPDEETLEAMIQRIKGP 646  Saccharothrix...
WP_061981624  567 EDTVDFSDNYDGRTQEPDVLPSRFPNLLVNGGSGIAVGMATNIPPHNLREVADGVKWALENYDATDDELLAALLVRIKGP 646  Amycolatopsis...
WP_091668925  565 EDTVDFSDNYDGRTQEPDVLPSRIPNLLVNGGSGIAVGMATNIPPHNLREVSSGVVWALENWEATDDELLAALLQRIKGP 644  Amycolatopsis...
WP_034267730  565 EDTVDFSDNYDGKTLEPDVLPARIPNLLVNGGSGIAVGMATNIPPHNLREVAEGVYWALDNWEAGDDETLAAMLQRIKGP 644  Haloechinothr...
WP_019810999  493 EETVDFSDNYDGRTQEPDVLPSRIPNLLVNGGSGIAVGMATNIPPHNLREVADGVIWALDHPEAGEEELLEALMERIKGP 572  Saccharomonos...
WP_140188131  655 DFPTAGLIVGGQGIKDAYTTGRGSVRMRGVVEIEEDARGKTSIVITELPYQVNPDNLITSIAEQVRDGKIAGISDIHDES 734  Rhodococcus r...
WP_156755406  533 DFPTKGLILGTAGIEDAYRTGRGSVRMRSVVEVEEDAKGRTILVVTELPYQVNPDNLIENIAQLVRDGKLTGISEIADES 612  Actinokineosp...
WP_035303300  591 DFPTKALILGTAGIEEAYRTGRGSVRMRAVVEVEEDAKGRTILVVTELPYQVNPDNLIENMAQLVRDGKLTGISEIADES 670  Actinokineosp...
WP_092786669  645 DFPTKALILGTQGIEDAYRTGRGSVRMRSVVEVEEDAKGRTILVVTELPYQVNPDNLIENMAQLVRDGKLTGISEIADES 724  Actinokineosp...
WP_133904066  648 DFPTHALILGTQGIEDAYRTGRGSVRMRAVVEVDEDAKGRTILIVTELPYQVNPDNLIENIASLVRDGKIGGIANVDDES 727  Actinophytoco...
WP_083668925  647 DFPTYGQILGTSGIEDAYRTGRGSVKMRAVVEIDEDAKGRVILVVTELPYQVNPDNLVENIAALVRDQKLTGIANIADES 726  Saccharothrix...
WP_061981624  647 DFPTKAMILGNSGIEDAYRTGRGSVRMRAVVEVEEDAKGRTILVVSELPFQVNPDNLVENIANLVRDGKLTGISDIADES 726  Amycolatopsis...
WP_091668925  645 DFPTRGQILGTQGLEDAYRTGRGSVRMRAVVEVEEDAKGRAVLVISELPYQVNPDNLVENIASLVRDGKLTGIADIADES 724  Amycolatopsis...
WP_034267730  645 DFPTKALILGTNGIEEAYRTGRGSVRMRAVVEVEEDAKGRTILVVSELPYQVNPDNLIENIAVLVRDGKLTGIADIADET 724  Haloechinothr...
WP_019810999  573 DFPTRGLILGTRGISEAYRTGRGSVRMRAVVEVEEDTKGRATLVVTELPYQVNPDNLVENIATLARDGKLTGIADIADET 652  Saccharomonos...
WP_140188131  735 SDRAGMRIVVTVRRDAVAKVVLNNLYKHTQLQTGFGCNMLSIVDGVPRTLRLDQMIRLYVTHQIEVIVRRTRYLLRKAEE 814  Rhodococcus r...
WP_156755406  613 NKRAGMRIVIGLKRDAVAKVVLNNLYKHTQLQHNFGVNMLALVDQVPRTLRLDQVIRHYVKHQVEVIRRRTEYRLRKAQE 692  Actinokineosp...
WP_035303300  671 NSRSGMRIVIGLKRDAVAKVVLNNLYKHTQLQHNFGVNMLALVDQVPRTLRIDQIVRHYVNHQIEVIVRRTRYRLRKAQE 750  Actinokineosp...
WP_092786669  725 NSRSGMRIVIGLKRDAVAKVVLNNLYKHTQLQHNFGVNMLALVDQVPRTLRLDQIIRHYVRHQLEVIVRRTRYRLRKAQE 804  Actinokineosp...
WP_133904066  728 SKRAGMRIVITLKRDAVAKVVLNNLYKHTQLQHNFGVNMLSLVDGVPRTLRLDQMIRHYVRHQVEVIVRRTRYRLRKAEE 807  Actinophytoco...
WP_083668925  727 NRRSGMRIVITLKRDAVAKVVLNNLYKHTQLQYSFGVNMLSLVDGVPRTLRLDQMIRHYVKHQIEVIVRRTRFRLRKAEE 806  Saccharothrix...
WP_061981624  727 NSRSGMRIVVTIKRDAVAKVVLNNLFKHTQLQQNFGVNMLALVDGVPRTLRLDQMIRHYVKHQIEVIVRRTRFRLRKAEE 806  Amycolatopsis...
WP_091668925  725 NSRRGMRIVVTLKRDAVAKVVLNNLYKHTQLQYNFGVNFLALVDGVPRTLRLDQMVRHYVKHQVEVIVRRTRFRLRKKED 804  Amycolatopsis...
WP_034267730  725 NSRSGMRIVITLKRDAVAKVVLNNLYKHTQLQHNFGVNMLSIVDGVPRTLRLDQIIRHYVHHQVEVVVRRTRYRLRKKEE 804  Haloechinothr...
WP_019810999  653 NSRSGMRIVITLKRDAVAKVVLNNLYKHTQLQYNFGVNMLALVDGVPRTLRLDQMVRHYVAHQIDVIVRRTRYRLRKAEE 732  Saccharomonos...
WP_140188131  815 RAHILRGLVKALDALDDVIALIRASATVEDARAGLIGLLDVDEIQADAILAMQLRRLAALERQKIVDELAEIELEIDNLK 894  Rhodococcus r...
WP_156755406  693 RAHVLRGYAKALDQLDAVIALIRSSPSADEARTGLMSLLEVDEIQATNILELQLRRLAALERQRILDELDDIERYIGELN 772  Actinokineosp...
WP_035303300  751 RAHILRGYAKALDMLDEVIALIRRSPSADEAKVGLISLLDVDEIQATAILELQLRRLAALERQRIIDELGEIERYIAELE 830  Actinokineosp...
WP_092786669  805 RAHILRGYAKALDMLDEVIALIRRSPSADEAKSGLIELLEVDEIQATAILELQLRRLAALERQRIIDELGEIERYIGELE 884  Actinokineosp...
WP_133904066  808 RAHILRGLVKALDMLDEVIALIRRSPTVDESRTGLMSLLEVDEIQANAILEMQLRRLAALERQKIIDELAEIETIIADLQ 887  Actinophytoco...
WP_083668925  807 RAHVLRGLVKALDQLDAVIALIRRSDTPEVARTGLMELLDVDEIQANAILEMQLRRLAALERQKIVDQLAEIELEIADYK 886  Saccharothrix...
WP_061981624  807 RAHILRGLVKALDMLDEVIALIRRSPSAEEARPALMSLLDVDEIQATAILDMQLRRLAALERQRIVDTLAEIELEIADLK 886  Amycolatopsis...
WP_091668925  805 RAHILRGFVKALDMLDEVIALIRRSPTVDQARTGLIELLDVDEIQATAILDMQLRRLAALEQQKIIDELAEIEREIADLK 884  Amycolatopsis...
WP_034267730  805 RAHILRGLVKALDMLDEVIALIRRSPTADQARTGLMELLDVDEVQATAILDMQLRKLAALEHQKIIDELAEIEREIADLK 884  Haloechinothr...
WP_019810999  733 RAHILRGLVKALDQLDAVINLIRRSPSADEARTGLMELLEVDEVQATAILDMQLRRLAALERQKITDELAEREATIADLK 812  Saccharomonos...
WP_140188131  895 DILAKPERQRAIVRDELKEIVDKYGDDRRTRIVAADGDVSDEDLIAREDVVVTITETGYAKRTKTDLYRSQKRGGKGVKG 974  Rhodococcus r...
WP_156755406  773 AILASDTRQREIIRDELKEIVEKFGDDRRTRIIPFDGDVSIEDLIAVEDVVVTITRTGYAKRTKTDLYRAQKRGGKGVQG 852  Actinokineosp...
WP_035303300  831 AILASEEQQRQIIRDELMEIVDKHGDDRRTRIIPFDGEVSVEDLIAVEDVVVTITRTGYAKRTKTDLYRAQKRGGKGVQG 910  Actinokineosp...
WP_092786669  885 EILASEALQRGIIRDELMEIVDKHGDDRRTRIIPFDGEVSVEDLIAVEDVVVTITRTGYAKRTKTDLYRAQKRGGKGVQG 964  Actinokineosp...
WP_133904066  888 DILAKPERQRNIVRDELMEIVDKHGDDRRTQIIPFDGDVSVEDLIAVEDVVVTITRTGYAKRTKTDLYRAQKRGGKGVQG 967  Actinophytoco...
WP_083668925  887 DILDKPERQRAIVREELLAIVDKHGDDRRTRIVPFDGDVSMEDLIAVEDVVVTITRTGYAKRTKTDLYRSQKRGGKGVQG 966  Saccharothrix...
WP_061981624  887 DILEKPERQRSIIAEELQEIVDKYGDDRRTKIIPFDGEVSVEDLIAVEDVVVTITRTGYAKRTKTDLYRSQKRGGKGVQG 966  Amycolatopsis...
WP_091668925  885 DILDKPERQRAIIRDELTAIVDKHGDDRRTTIIPYDGDVSVEDLIAVEDVVVTISRTGYAKRTKTDLYRSQKRGGKGVQG 964  Amycolatopsis...
WP_034267730  885 DILERPERQRQIIKDELKAIVDKRGDDRRTQIIPYDGDVSVEDLIAVEDVVVTITRTGYAKRTKTDLYRSQKRGGKGVQG 964  Haloechinothr...
WP_019810999  813 DILDKPERQRSIVRTELAEIVEKYGDERRTQIIPYDGDVSAEDLIPVEDVVVTITRTGYAKRTKTDLYRSQKRGGKGVQG 892  Saccharomonos...
WP_140188131  975 ADLKQDDIVKHFFVTSTHDWLLFFTTKGRVYRAKAYELPEANRTARGQHVANLLAFQPDERIQGVIRLKSYEDAPYLVLA 1054 Rhodococcus r...
WP_156755406  853 AALKQDDIVAHFFVCSTHDWMLFFTNKGRVYRAKAYELPEANRNARGQHVANLLAFQPDEQIAQVIQIKDYTAMPYLVLA 932  Actinokineosp...
WP_035303300  911 ATLKQDDIVAHFFVCSTHDWILFFTNKGRVYRAKAYELPEANRAARGQHVANLLAFQPDEQIAQVIQIKDYTVAPYLVLA 990  Actinokineosp...
WP_092786669  965 ATLKQDDIVAHFFVCSTHDWILFFTNKGRVYRAKAYELPEANRAARGQHVANLLAFQPDEAIAQVIQIKDYTAAPYLVLA 1044 Actinokineosp...
WP_133904066  968 AGLKQDDIVAHFFVCSTHDWILFFTNKGRVYRAKAYELPEANRNARGQHVANLLAFQPDERIAQVIEIKDYQVAPYLVLA 1047 Actinophytoco...
WP_083668925  967 AQLKQDDIVQHFFVCSTHDWILFFTNKGRVYRAKAYELPEANRNARGQHVANLLAFQPEEEIAQVIQIKNYDVAPYLVLA 1046 Saccharothrix...
WP_061981624  967 ATLKQDDIVQHFFVCSTHDWILFFTNKGRVYRAKAYDLPEANRNARGQHVANLLAFQPDEKIAQVIEIPNYEVAPYLVLA 1046 Amycolatopsis...
WP_091668925  965 ATLKQDDIIQHFFVCSTHDWILFFTNKGRVYRAKAYDLPEANRNARGQHVANLLAFQPDEQIAGVIQIKNYEVAPYLVLA 1044 Amycolatopsis...
WP_034267730  965 ATLKQDDIVQHFFVCSTHDWILFFTNKGRVYRAKAYELPEASRNARGQHVANLLAFQPDEEIAQIIQIADYEVAPYLVLA 1044 Haloechinothr...
WP_019810999  893 TTLRQDDIVQHFFVCSTHDWILFFTNKGRVYRAKAYDLPEANRSARGQHVANLLAFQPEEHIAGVIQIRDYQVAPYLVLA 972  Saccharomonos...
WP_140188131 1055 TRNGLVKKSRLSDFDSNRSGGIVAINLRGDDELVGAVLCSSDDDLLLVSAKGQSIRFVASDEVLRPMGRATSGVQGMRFN 1134 Rhodococcus r...
WP_156755406  933 TRDGLVKKSRLADFDSNRAGGLIGINLREDDELVGAVLCSAEDDLLLISAGGQSIRFHATDEALRPMGRATTGVQGMRFN 1012 Actinokineosp...
WP_035303300  991 TRDGLVKKSKLADFDSNRAGGLIGINLREEDELVGAVLCSADDDLLLVSAGGQSIRFHASDEALRPMGRATSGVQGMRFN 1070 Actinokineosp...
WP_092786669 1045 TRDGLVKKSKLVDFDSNRAGGLIGINLREDDELVGAVLCSADDDLLLVSAGGQSIRFHASDEALRPMGRATSGVQGMRFN 1124 Actinokineosp...
WP_133904066 1048 TKSGLVKKSRLSDFDSNRAGGLIGINLREDDELVGAVLCAAEDDLLLVSAGAQSIRFHASDEALRPMGRATSGVLGMRFK 1127 Actinophytoco...
WP_083668925 1047 TKKGLVKKSKLSDFDSNRAGGLIGINLRDDDELVGAVLCSATDDLLLVSADGQSIRFHASDEALRPMGRATSGVLGMRFN 1126 Saccharothrix...
WP_061981624 1047 TRRGLVKKTKLTDFDSNRAGGLIAVNLREGDELVGAVLAAAEDDLLLVSAEGQSIRFHATDEALRPMGRATSGVLGMRFN 1126 Amycolatopsis...
WP_091668925 1045 TRKGLVKKTKLTDFDSNRSGGLIAVNLREGDELVGAVLVSAEDDLLLVSSEGQSIRFHATDEALRPMGRATSGVLGMRFN 1124 Amycolatopsis...
WP_034267730 1045 TKAGLVKKSRLSDFDSNRSGGLIGINLRDGDELVGAVLASGDDDLLLVSADGQSIRFHASDDVLRPMGRATSGVLGMRFN 1124 Haloechinothr...
WP_019810999  973 TRKGLVKKSRLSDFDSPRSGGLIGINLREGDELVGAVLASAEDDLLLVSSDGQSIRFHATDEVLRPMGRATSGVLGMRFN 1052 Saccharomonos...
WP_140188131 1135 EDDALLSLNVVREGTYLLVATSGGYAKRTPIEDYMAQGRGGKGVLTIQYDRKRGTLVGALIVDDDDELYAITSGGGVIRT 1214 Rhodococcus r...
WP_156755406 1013 TGDELLALGVVKEDTFVLVATDGGYAKRTPIEDYSRQGRGGKGVLTIQHDSRRGRLVGAVIVEPEDQLYAITSSGGVIRT 1092 Actinokineosp...
WP_035303300 1071 SGDELLTLGVVKEGTFVLVATDGGYAKRTPIEDYSVQGRGGKGVLTIQHDSRRGRLVGAVIVELEDQLYAITSSGGVIRT 1150 Actinokineosp...
WP_092786669 1125 AGDELLTIGVVKEGTFVLVATDGGYAKRTPIEDYSVQGRGGKGVLTIQHDSRRGRLVGAVIVELEDQLYAITSSGGVIRT 1204 Actinokineosp...
WP_133904066 1128 EGDELLTLGVVREDTFLLVATNGGYAKRTPIDDYPLQGRGGKGVLTVQYDSRRGRLVGAVIVDEDDELYAITSAGGVIRT 1207 Actinophytoco...
WP_083668925 1127 TGDELLSMGVVQEGLFVLVATDGGYAKRTPIEDYPVQGRGGKGVLTIQHDRRRGRLVGALIVDVDDELYAITSSGGVIRT 1206 Saccharothrix...
WP_061981624 1127 DGDELLGINVVQPDKFLLVATDGGYAKRTPTDDYPVQGRGGKGVLTIQYDRKRGRLVGAVIVDAEDELYAITSSGGVIRT 1206 Amycolatopsis...
WP_091668925 1125 EGDELLGIGVVKEDKFLLVATDGGYAKRTPIEDYPVQGRGGKGVLTIQYDKKRGRLVGALIVDADDELYAITSSGGVIRT 1204 Amycolatopsis...
WP_034267730 1125 EGDELLAMDVVQEGTFLLVATTGGYAKRTAIEDYPVQGRGGKGVLTLQYDNRRGRLVGALIVNTDDELYAITSTGGVIRT 1204 Haloechinothr...
WP_019810999 1053 DGAELLSVNVVRPDTDLLVATDGGYAKRTPVEEYPVRGRGGKGVLTIQHDERRGALVAALIVDIEDELYAITSSGGVIRT 1132 Saccharomonos...
WP_140188131 1215 PAKQVRKAGRQTKGVRLMNLGEGDTLLAIARNADEPEE 1252 Rhodococcus ruber
WP_156755406 1093 TAGEVRKAGRQTKGVRLMNLGVGTTLIAIARSADETAA 1130 Actinokineospora pegani
WP_035303300 1151 AAKEVRKAGRQTKGVRLMNLGEGTTLVAIARSAEATAE 1188 Actinokineospora inagensis
WP_092786669 1205 TAKEVRKAGRQTKGVRLMNLGEGTTLVAIARSAEVAAE 1242 Actinokineospora terrae
WP_133904066 1208 SAREVRKAGRQTKGVRLMNLGDGTTLVAIARSAEVESA 1245 Actinophytocola oryzae
WP_083668925 1207 SAKEVRKAGRQTKGVRLMNLGEGTTLIAVARNADEPAD 1244 Saccharothrix sp. CB00851
WP_061981624 1207 SAGQVRKAGRQTKGVRLMNLDEGTTLLAVARNADEPSD 1244 Amycolatopsis regifaucium
WP_091668925 1205 AAGQVRKAGRQTKGVRLMNLGEGTTLLAVARNADEPSD 1242 Amycolatopsis marina
WP_034267730 1205 GSDQVRKAGRQTKGVRLMNLDEGTTLLAVARNADEPND 1242 Haloechinothrix halophila
WP_019810999 1133 PAGEVRKAGRQTKGVRLIDLGEGNALLAVARNADRPSD 1170 Saccharomonospora halophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap