Conserved Protein Domain Family
IscA_HesB_Se

?
NF038090: IscA_HesB_Se 
IscA/HesB family protein
Members of this family, a large fraction of which are selenoproteins, are homologous to proteins of iron-sulfur cluster biosynthesis such as IscA, and belong to the broader set of HesB-related proteins.
Statistics
?
PSSM-Id: 411672
Aligned: 12 rows
Threshold Bit Score: 135.919
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PLX50690       1 MLEVSQAALTNVKEYLRQQKIDSPIRVTMISgGCAGSSLSLALDEATDQDHVFSHG-GIGFVVDKSLLASCGRIKVDFIE 79  Desulfobulbacea...
GBE12648       1 MLEVTDLAVRKIKEHLAQNKIDSPVRVIILN-SCSGSSLSLALDERKETDTAVELE-GLSVVIDQELMGRCGAVKVDFVE 78  bacterium BMS3A...
WP_136874170   1 MLEVTTLASEKLVEYMQVNNISSSLRVALMQgGCSGPSLGLALDEEKATDELFAKE-KLTFLIAKDLLEQCGSITVDYAD 79  Desulforhopalus...
WP_073613532   1 MLEVTAEAHDKLTEYFKENNLTSSLRIFLNHgGCSGPTLGLALDEAKAEDERFEQQ-DLQFLIEKNLLQQCGSITVDYIN 79  Desulfopila aes...
WP_013163489   1 MLEITELASKKLKAYLEDNSIDSPVRVALMQgGUAGPSLGLALDEPKENDTTHTQD-GVKYLIDNGLSQQCGAVKIDFID 79  Desulfurivibrio...
PLX46420       1 MFEVTELATQNLKSYMDQNKIDSALRVALMGgGUSGPSLGLALDEPKETDAKYEQD-GLTFLVDNNLLDTCGAIKIDFID 79  Desulfobulbacea...
RLB10828       1 MFEVTEKASNMIKEFLKDKEEIPPIRIMLSQgGUAGPSLGMALDEQRDNDAVFDDR-GITYVIDKGLFEQIKPIKVDFVD 79  Deltaproteobact...
WP_084457924   1 MFELTDKAREELLSYFSDKS-ISPIRVYLAPgGUAGPRLSLALDEPKETDSVFDFDgGITFVIDKSLLESAAPVKVDVTY 79  Desulfocurvus v...
WP_144303923   1 MVNVSDNAMKELEAYFADKE-KSPIRVYLAPgGUAGPRLALALDEPNDNDEVVELN-GFKFVVEKDLLEKAKPISIDISY 78  Desulfovibrio i...
WP_021761071   1 MVTLTDNAIRELDAYFADKP-KSAIRVYLAPgGUAGPRLALALDEPNDKDEVFTQG-DYSIIMERELFNQAKPLRIDVSY 78  Desulfovibrio g...
PIE71660       1 MIEVTEAAQQQVAEYFKDKA-LMPIRVFLNSgGUAGPSLALALDETKEDDAVFEFA-GISYVMEKKLMAEAQPVKIDFNH 78  Deltaproteobact...
WP_139264898   1 MLECTQAATDKIKEYFESQPKVVPVRVFLNQgGUAGPSLALALDESRENDESYEVD-GLTFVVDKAFLAQASPIKIDYSM 79  Desulfatibacill...
PLX50690      80 kkeggcgCggSGGFSVTSEKPLS--SGACGC 108 Desulfobulbaceae bacterium
GBE12648      79 pgg--cgC--SSGFSITSTMPLSg-NSGCGG 104 bacterium BMS3Abin13
WP_136874170  80 a-----gS--RSGFTITSANPLPnvGGGCSS 103 Desulforhopalus sp. IMCC35007
WP_073613532  80 a-----gK--QSGFSIRPSTPLPgaGGGCSA 103 Desulfopila aestuarii
WP_013163489  80 a-----gA--RSGFSITPANPLg--GGGCGS 101 Desulfurivibrio alkaliphilus
PLX46420      80 s-----gM--RSGFSISSVKPIs--GGGCSS 101 Desulfobulbaceae bacterium
RLB10828      80 -------SpfGSGFSIQSNMVM---GAACGS 100 Deltaproteobacteria bacterium
WP_084457924  80 -----------TGFTVDSSLQLG--GGGCGS 97  Desulfocurvus vexinensis
WP_144303923  79 -----------MGFTVDSAMPLG--GGSCST 96  Desulfovibrio indonesiensis
WP_021761071  79 -----------MGFSVESSLQLG--GGGCSS 96  Desulfovibrio gigas
PIE71660      79 -----------MGFKIDSSMKFEs-GGGCSG 97  Deltaproteobacteria bacterium
WP_139264898  80 -----------LGFEINSAYELPk-GGDCGG 98  Desulfatibacillum alkenivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap