Conserved Protein Domain Family
DHCW_cupin

?
NF038084: DHCW_cupin 
DHCW motif cupin fold protein
Members of this uncharacterized protein family resemble other cupin superfamily small barrel proteins. This family has a signature motif, DHCW, for which the family is named.
Statistics
?
PSSM-Id: 411667
Aligned: 41 rows
Threshold Bit Score: 187.441
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_005984631   4 DEIPFGTTDWDSVERTEHKGDTGVAYWRTRSFGDpknpIRVRMVEYSPGYRADHWCSKGHILLCLEGKLETTLEDGRTFT 83  Desulfocurvibac...
WP_006716467   4 QNVPFGTIDWNTIVPTIHNGVTGEAYWRTFEMGN----IRVRMVEYTPGYMADHWCSHGHVLLVLEGELVTELDDGRKFV 79  Desulfitobacter...
WP_006301877   4 QDVPFGVTRWEDVEPTEHRGEEGVALWRTFEGGN----LRVRVVEYSPGYRADHWCARGHVLYVLSGTLVTELKDGRVFT 79  Aminomonas pauc...
WP_007004941   4 PALPFTVTDWSQVEPTRHPGETGEALWRSFTVGD----LRVRLVEYSPGYLADHWCDRGHVLFVLEGTLETELKDGRRFT 79  Roseomonas cerv...
WP_018061152   4 PDSPFTAVDWSRIEPTVHPGERGEATWRTLNVGD----MRLRRVDYSPGYLADHWCDRGHVIFVLEGELVSELKDGRATT 79  Caulobacter sp....
WP_007702712   4 PELAFTTTNWDEVPATRHEGESGHALWRTLNIGD----IRIRVVEYTPGYVADHWCDRGHVIYVLEGELISELKDGRVSV 79  Agrobacterium
WP_008713131   4 EGVPYQTVDWNKIESVAHGGESGEALWRTFEKGN----VRARVVEYGAGYLADHWCPRGHVLFVLEGSVISELEDGTKEE 79  Cloacibacillus ...
WP_007810102   2 SAIPFQTIDWNQISKTEHLGETGKAYWQTIQLGN----LRIRKVTYSENYIADHWCRKGHIVHCLEGDFISELENGEKFS 77  Flavobacterium ...
WP_014083765   3 SNIPFQIIDWSQIQETFHPGFTGTSDWKTIQFDG----FKVRIVKYSAGYLADHWCQKGHIVYCLDGEFESELETGEIFR 78  Flavobacterium ...
WP_007138739   2 PNIPFQAINWDNIEKTEHPGETGAVISQTIQIGG----LRIRKVTYSENYQADHWCQKGHVVHCLKGHLISEMESGEETY 77  Flavobacterium ...
WP_005984631  84 LTPGVSYQVAD-NAEAHQSYTEMGAKLFIVD 113 Desulfocurvibacter africanus
WP_006716467  80 LTPGTSYQVAD-ETNPHRSYTEKGAKLFIVD 109 Desulfitobacterium metallireducens
WP_006301877  80 LTPGMSYQAEDdPENPHRSRTETGATLFIVD 110 Aminomonas paucivorans
WP_007004941  80 LRPGMSYQVSDfGDAAHRSSTTTGAKLFIVD 110 Roseomonas cervicalis
WP_018061152  80 LTAGMSYHVSDfGDPAHRSSTSVGAKLFIVD 110 Caulobacter sp. UNC279MFTsu5.1
WP_007702712  80 LTKGMGYQVSDfGDAAHRSSTETGAKLFIVD 110 Agrobacterium
WP_008713131  80 LTPGMGYVAEDdGKNRHRSFSPNGVKLFIVD 110 Cloacibacillus evryensis
WP_007810102  78 LSKGMTYIVSD-DVSSHRSITTKGVELLIID 107 Flavobacterium sp. CF136
WP_014083765  79 LSKGMSYIVSD-DSSSHRSISKNGVSLLIID 108 Flavobacterium branchiophilum
WP_007138739  78 VSEGMSYVVSD-NESSHRSISVNGAELLIID 107 Flavobacterium frigoris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap