Conserved Protein Domain Family
TonB_sider_MxcH

?
NF038079: TonB_sider_MxcH 
TonB-dependent siderophore myxochelin receptor MxcH
Statistics
?
PSSM-Id: 411662
Aligned: 26 rows
Threshold Bit Score: 1125.44
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KYF66359                   37 PPKLVEGMEAEYPPEARAARQEGRVVLKLLIDASGRVTEADVATPAGHGFDEAARAAALRFRFTPARRGGTPVASRILYG 116 So...
WP_146654833               62 PPELLEASEAEYPAEARAEGIEATVVLRIDVDVEGRVTRAEVHVPVGFGFDEAAKAAALRLRFAPARRDGQPIAVRILHR 141 La...
PRJNA294368:SOCE26_046770  72 APELVEPAEAAYPEGARAAGQEGTVVLKLTIDAVGRVTQADVATPAGHGFDEAAQEAALRIRFRPARRGDRSVASRILYR 151 So...
WP_136919895               40 PPELIEIVQAAYPEEARAGGREGRVVLRLRIDAEGRVTKVEVTESAGNGFDEAAQEAALQFRFAPARRGEVPVASLILYA 119 Po...
WP_146730426               42 PPHLVEPVEAAYPESAKSLGIEATVLLRITVDKTGRVTAAEIIEPAGHGFDEAAREAALRLRFEPARQGDRPVAARILYR 121 Mi...
WP_074957877               47 VPRRIDSVVVPYPQAEQAARREGEVVLRLTLDETGVVTDSEVVRSAGPAFDEAVRTASLSFRFEPARVRGEPVACQIELV 126 My...
WP_095960551               37 PPSRIDSVDVPYPAAELAAGREADVLLRLTIDEHGVVTESEVVRSAGEAFDEAIRTASRSFRFEPARVGGEPVACQIELL 116 Co...
WP_108065768               30 APRRTDTVEVPYPESELAARREADVVLMLTLDENGAVTESEVVRSAGAAFDEAARAASLTFRFEPARMEGRPVACRIELV 109 Vi...
WP_044181810               30 PPHRIDTVEIPYPAEELAARREGEVVLLLTIDEKGIVTGSEISRSGGAAFDAAAQSASLTFRFEPARVDGEPVACRVEFV 109 Hy...
WP_074958595               65 PPSLVSKPEAVYPPEALAAKVEGAVKLLLTLDEEGRVTRAQVVEGLGHGLDEAVVDALAKARFTPAMQDGTPVACQFEFI 144 My...
KYF66359                  117 YDFRLPEGPSAPastardreqdggsaaresAPAAEPAQVAEParVS----------APAPQPAQapgp--aagaAPIAVT 184 So...
WP_146654833              142 YDFRLPEPAPVEtp-----------------pAPAPSASEAApaAP----------APPAPPAKd---------APMEVT 185 La...
PRJNA294368:SOCE26_046770 152 YVFRLPEPP---------------------AAAAPALATAAAapAAatpaaasvaaTPAAAMPAaat----laaTPIEVN 206 So...
WP_136919895              120 YEFKLPPEP---------------------APAEEAR---APapPEppapaaqtqiIPAKPP--------------IEVM 161 Po...
WP_146730426              122 SIFQPPPPPQPSp-----------------pLPPPPPSAPSPdiAP----------KSPPSPEPlkapfktrkdAPLEVR 174 Mi...
WP_074957877              127 HTFQLD--TPPPvaa------------petPTQQPAAT------------------PEATATAPe--------eKKLETT 166 My...
WP_095960551              117 HAFRLD--PAASavp------------papEAAPEPAPP--ParAE----------AP-APPPPe--------eKTLETT 161 Co...
WP_108065768              110 HSFRLAPEAPASpap------------aepTASAETTTPAEPv-------------pAEPTPTGe--------eRVHKTT 156 Vi...
WP_044181810              110 HSFRLAPEAPASpea------------papPETPTASEPGLPtpDD----------AAAATPAKe--------eKVTETT 159 Hy...
WP_074958595              145 HHFVLAAPA---------------------EAAPHVAESPAPqapv------seapAQPAPESKsp---------sFTSI 188 My...
KYF66359                  185 VRG--AEAERLRQSAQAITVIETEEAQRRTADMGEVLARTQGVGVRKSAGLGSWARFSLNGLTDDQIRFFLDGVPLELAG 262 So...
WP_146654833              186 VRGm-TEGERLQSSAQAVHVVDTKLAKREAADMGEVLARSEGVSVQRGGGLGSSMRLSLNGLTDEQVRFFLDGVPLELSG 264 La...
PRJNA294368:SOCE26_046770 207 VRGv-PEAERLRRSAEAVQVVETGAARRQSADLGEVLARSEGVSVRRGGGLGSATRFSLNGLTGDQIRFFLDGVPLALSG 285 So...
WP_136919895              162 VRGp-SEADRLRRSAQAVHVLETEQAQRQTADLGEVLARSEGVGVRRGGGLGSNARLSLNGLTGEQIRFFLDGVPLDLAG 240 Po...
WP_146730426              175 VEGqtSEAEQRRQSAEAVTVVETRTARKQTADLGEVMARVPGVAVRRSGGLGSAAVFSLNGLYDDQIRFFLDGVPLELSG 254 Mi...
WP_074957877              167 VSGr-SDAERQRQSAEAVKVVSVQRARARSVDMGQVLAAQEGVEVRRTGGLGSSASFTLNGLTDDQVRFFLDGVPLDLSG 245 My...
WP_095960551              162 VSGr-SEAERRRQSAEAVRVVSTTRARARSVDMGQVLAAQEGVEVRRSGGLGSTIRFSLNGLTDDQIRFFLDGVPLDLSG 240 Co...
WP_108065768              157 VRGq-SEAERMRQSAEAVKVVDTRHAKAQSADLGQVLAQQEGVAVRRTGGLGSSARFSLNGLSDEQIRFFLDGIPLELAG 235 Vi...
WP_044181810              160 VRGr-SEAERMRQSAEAVKVVEIRRARAQSADLGQVLAQQEGVSVRRTGGLGSTARFALNGLTDDQIRFFLDGLPLELSG 238 Hy...
WP_074958595              189 VRGkaTEARALVRGSEAVDVVELEKAQERAEDLAEVLTRASAVQVQRTGGLGSRTQLSLGGLSGDQVRVLLDGVPIEYSP 268 My...
KYF66359                  263 YPFGISNVPVNLIERVEIYRGVVPVRLGADALGGAVNLVTDRDVR-GTHGAASYEIGSFDTHRLALAARHLHEPSGFFAR 341 So...
WP_146654833              265 YPWGISNVPVNLVKRVEVYRGVVPIRFGADALGGAVNLASDTEVK-GTHGAASYQIGSFGTHRTTLGVQTLDDETGLFAR 343 La...
PRJNA294368:SOCE26_046770 286 YSSGIANVPVNLVERVEIYRGVVPVRFGADALGGAVNLVTD-RVApGTRASASYQVGSFGTYRMTLGARHADGPSGLFAR 364 So...
WP_136919895              241 YAHGITNVPVNLVERVEIYRGVVPVRFGADALGGAVNLVTD-PEVrGTHASASYQVGSFKTYRWTLDARHLHEPSGFFAR 319 Po...
WP_146730426              255 YPFGITGVPLDFVERVEVYRGVVPVRFGADALGGAVNLVTN-QTY-DTRAAASYQVGSFATYRAALQGRYRHDASGFVVS 332 Mi...
WP_074957877              246 YPFGIANVPVNLVDSIQLYRGVVPIRYGADALGGAVNLTSTPLEP-GAHGAVSLQGGAFGTFRLTLGGGYKPAPTGFYAR 324 My...
WP_095960551              241 YPFGFANVPVNLVDSIQIYRGVVPSRFGADALGGAVNLTTAPLQQ-GAHGAVSLQGGAFGTYRLTLGGGYRPAEHGFYTR 319 Co...
WP_108065768              236 HPFGIANVPVNLVERIEVYRGVVPVRYGADALGGAVNLVSAPLRG-GAHGAISLQGGSFGTWRLALAGSYSQEPGGFFAR 314 Vi...
WP_044181810              239 YPFGVANVPVNLVDRIELYRGVVPARYGADALGGAVNLVSAPLQE-GAHGALSLQGGSFGTWRLTLAGSYQPKPQGFFVR 317 Hy...
WP_074958595              269 YVYGLGSVPVSLIRQMEVFNGVVPVRLATDALGGAIHLRSDLSAP-ETGASLSLQAGSFGSYRGTGRGT-WRANEHVFVR 346 My...
KYF66359                  342 MDGFFDHAKNDYPV-DVEVPD-AKYVERPARVYRFHDAYRAAGGGVELGFVNRPWARRLLLRAFLTTYDKEHQHKLAVMk 419 So...
WP_146654833              344 VSGFFDHADNDYPI-EVDAPD-KQGRLSTVTVNRFHDAYSAWGANAEAGFVRRPWAKRLLVRAFVADYSKELQHNPVMTv 421 La...
PRJNA294368:SOCE26_046770 365 ASAFLDHARNDYPMkDVEVAd-ELGRPTRADVHRFHDRYRAAGGAIEGGWLRRPWADRLLLRAFYAAHDRDVQHNLFMt- 442 So...
WP_136919895              320 VNGFYDRTQNDYPV-DVEVFd-DLGRLSPARVHRFHDGYRAGGGSVEVGFVRRPWAERLLVRAFYTEHQRDVQHNALMs- 396 Po...
WP_146730426              333 LNGFVDHSNNNYLI-DVQAPD-DKGRLSPVRVPRFHDAYTAFGGAVEVGFVDRPWAKRLLLRLSLADYDKDLQHNT-IMt 409 Mi...
WP_074957877              325 AHFFADTTKNNYAI-DVEAAD-DRGNLRPVTVKRFHDGYEALGGGVEVGFTELSWADRVVLRAFGSRNDKELQHNLVMA- 401 My...
WP_095960551              320 AHLFADTTRNDYRV-DVEDAD-DSGQVRDVTVKRFHDGYQALGGGLEAGFEQAGWADRVALRVFGSGFDKDLQHNQVMSg 397 Co...
WP_108065768              315 AHLFADTARNNYPI-DVEVAD-DQGRLQQATVPRFHDGYKALGGGLDVGLMSLGWADRLVFRAFGSGTGKELQHNLVMRg 392 Vi...
WP_044181810              318 AHLFADTTRNDYRV-DIETVD-EQGQLLPATVKRFHDGYRALGGGLDVGLESLGWADRLVFRAFGSGHDKELQHNLVMRg 395 Hy...
WP_074958595              347 AAGFHDRAQNDYRI-TVDVADrVTGRVGPRALSRSHDAYRGSGGSLELGVESLPGLDRLVLTGYLGQYDKEVPHDQLMIr 425 My...
KYF66359                  420 VPYGEVTNGETTTGVSLRYEQPL-GRGVALDAIAGYAYGRATFLDVSECTYDWYGRCEPG--KPGEDDTRPRDQVFWEHS 496 So...
WP_146654833              422 -PYGEVSYDRMTAGGSLRYENVF-ARSFPVDVVAGYSFAQTNFRDLSKCIYNWYGNCIGQrqRAGELENKPHDQVVWDKS 499 La...
PRJNA294368:SOCE26_046770 443 VPYGEVTYGRQSGGGHVRYEQPlsgRRLRLDAVAGYALARTVFRDLGTCRHDWRRRCMRSipQPGE-MGSAADQAVLQHT 521 So...
WP_136919895              397 VPYGEVTYGKQSAGAHLRYAQPl-sRRIRLDAVAGYTYVRTAFRDLSTCRYDWLGHCVFElpQRGEIEARAIDQIVEQHN 475 Po...
WP_146730426              410 IPYGEVTYGERVYGATARYEQVI-GENVEVGIIAGYARRAIDLLDRSEWIYDWYGHRIRPraQLGELGDGARDQTVWRDG 488 Mi...
WP_074957877              402 APYGEATYDADSLGAQLLYAKTL-SPTVRLDALAGYAWQATRLVDIAEWGYDWFGNRTVPreLPGEIGGGAIDQTVWQQT 480 My...
WP_095960551              398 GPFGEARYGATSAGTQLLYEKAF-TDAVRFDALAGYAWQATDFQDTSPWVYDWFGNRVRErrEAGELGGDATDQTLWQQS 476 Co...
WP_108065768              393 VPYGEAHYGVTSAGGQLLYEKAF-TEALRLDVVGGYGWQATDFVDVSNWVYDWYGQRVRErtLPGEIGGEATDQTLRQHA 471 Vi...
WP_044181810              396 TPYGEASYGVTTAGGQLLYEKAF-TEALRLDAVVGYGWQATEFVDVSRWVYDWFGRQVRErtLPGEINNQATDQTLWQHA 474 Hy...
WP_074958595              426 -PYGAVTSGQESYGVGLRYEVSa-hERLKVLAIAGYNQRIGELYDVSNCLYDWYGVCQDTqaRAGEIGSSPLENTQKRQT 503 My...
KYF66359                  497 GYGRLNLRFRPHPEHALQISVSPMFVTRTGDERRQANPEGRDPLTADRDLVNWVHGVEHQLNLFDDRLENLLFAKQYVQL 576 So...
WP_146654833              500 VYARANAGWRIHPEHTVRLAVAPTYTYRTGEERTPLDPTARDPLTASRRLLTVVSGLEETSEFFERRLENIVFVKDYYQV 579 La...
PRJNA294368:SOCE26_046770 522 AFASVNLALRVRPEDLVRFGVAPTYTSRTGKNRAIREG--YDPLTARRRLLGGVAGVEYEAKRLDGRLANIAFAKAYVQA 599 So...
WP_136919895              476 AFARFNLAWNPAPWHSLRFGLSPTYAARTGKDHALPAND-YDPLTAERDLLSGVAGAEYEARPFSGRLANIAFVKGYMQQ 554 Po...
WP_146730426              489 MIGRAHMAVRVRPELAVRASVSPTFATQAGENRLADNPSGRDPLTARNSQWNVVSGLEGELKLFGDRLENVLFVKDYTMQ 568 Mi...
WP_074957877              481 AYGRVNVGWDVAPSHTLRLALAPTVTTRTGEERRRASPSDPDSLAPRRTQLTFVTGLEYQVDLLDDALEVIVFGKDYLYQ 560 My...
WP_095960551              477 FYGRANASWALTPTQTLRLAFAPTLSRRTGEERRLASPSDADPLSADRDILTAVTGLEYQLNAFNDALELIVFAKDYLYA 556 Co...
WP_108065768              472 AYGRANVAWTLSDSQRLRLSLAPTQTWRTGEQR--LTTNGQDPLAAERELFTAVLGLEYELDLFDDALEVILFGKDYHYV 549 Vi...
WP_044181810              475 LYGRAHADWAFASAQKLRLSIAPTRTWRTGEDR--LSTPELDVLAAERTLFTSVIGLEYELALFDDTVQVILFGKDYRYA 552 Hy...
WP_074958595              504 LFGRVRLLGTLFDAEDLELSLGADDSDRTGENAYLTRLGQEDPLRIPLGLTSGFGGLSHRQTLWEGRLENTLFVKGYVQR 583 My...
KYF66359                  577 VRSEESLQGLAdrFIRRDRDTHRLGVGDGLRYRFTGWLYAKASYEWARRLPRPDEVFGDGALIRGNLELSPETSHNGNVG 656 So...
WP_146654833              580 ARAEQPLTGSNv-FNERPRDTHQVGFGDAVRYRFVQWLYGKASYEYATRLPTTTETFGDGVLVAENLGLEPETSHNVNVG 658 La...
PRJNA294368:SOCE26_046770 600 VGTKEQLPSGV--VRDLDVTRHRLGIGDSLRFRFTEELYAKASYELATRLPSADEMFGDGGVITDSLHLRPEVSHNVNAG 677 So...
WP_136919895              555 ARTKEQLPNGY--LRDLDRSSNRAGIGDSLRFSFTDAFYAKASYEYATRLPNPEEVFGNGALVIENLHLEPEVSHNVNVG 632 Po...
WP_146730426              569 SSTHEVTSSG---VRAKERSTHRLGAGDALRFRFTPWLYAKASYEYATRLPRPDELFGNGVLINASLDLEPERSHNVNVG 645 Mi...
WP_074957877              561 GRARQPLAVGG--WLDKDKGLHQLGGGASMRLRLGTPLYLKASYERATRLPRADEVFGNGVLVLENLDLEPEHSHNLNLS 638 My...
WP_095960551              557 ARAQQLQPTGA--WLSKDRDLHQLGGGAAIRLRVAEPIYVKVSYERATRLPRMDELFGNGVLVRENLDLAPETSHNVNAG 634 Co...
WP_108065768              550 ARAQALAAGGG--WRREDRDQQQLGGGVALRVRLASPLYLKVSYERATRHPRVDEVFGNGVLIHENLELEPELSHNINLG 627 Vi...
WP_044181810              553 ARAQERAVGGG--FQRKDRDLQRFGGGLAMRVRLGEPLYLKASYERATRFPRVDELFGNGVLISENLDLESEGSHNLNLG 630 Hy...
WP_074958595              584 ------LTSGT--NAQLSETRWAGGYGDTLRFSVTRWLLLKASYERTTRMPRVEELFGDGGLLVESTALLPESSHNANVG 655 My...
KYF66359                  657 VTVDARDTAAGAWRIEANGYLREAEDLIVLFGNGQISRYDNVFSARAMGVEASAGWTSPDEHVALNGNVTYEDFRNTSRE 736 So...
WP_146654833              659 ATVDVRDTGIGDFRADTNGFLRAADKLIVLLGNDRNFQYQNVYSARALGVETQGGWTSPGEYLALDGNVTYVDFRNTENE 738 La...
PRJNA294368:SOCE26_046770 678 VTLERAETGFGALRFEVNGFGRFAEDLIRLGGQASYAKYENFPSARSVGFESAVGWTSPGERLALDGQLTWQDFRNTTSE 757 So...
WP_136919895              633 LTLERAETAAGQLRFNVNGFGRFAENLIVLLSAGNYFQHENVLSARSVGVEAALGWTSPGDWLSLDGYVTWQDFRNTASE 712 Po...
WP_146730426              646 PRLDLKRTPAGDFVVDINGFLRDTDRMIVLLGNDRSFQYQNVYHARSLGIEGSASWVSPGRWVTLDGSITLQDIRNASSE 725 Mi...
WP_074957877              639 LSTVPLRTRAGSFRGEVNGFARFADNLILLTGRDRDWSYQNVYGARILGVELSAGWTSTGGLFSVDANATAQDPRNASSQ 718 My...
WP_095960551              635 LATAPLRTRLGVFRGELNGFARLAQDLIMLAGRERDWTYQNVYGARALGIEGATGWSAPGGWLHVDANATFQDIRNTSSQ 714 Co...
WP_108065768              628 LATSPLRSGLGTFRGELNGFARLAQNLIILLGDNRDWRYQNVYGARVLGVEGSAGWSSSGSLFHVDANATVQDARNASAQ 707 Vi...
WP_044181810              631 VATQPLRSGLGTFRAELNGFARLVSNQIILLGDARKSSYQNVYGAHALGFEVAAGWNSVGRLFYLDANATLQDLRNTSGE 710 Hy...
WP_074958595              656 VELLSLVTPVGRFGANASAGLRDVENLIQLFPGDTTQAYENVDHARSVTAHAGLDWDSPGDWVGLTGAVTWLDFKNLAEE 735 My...
KYF66359                  737 GTFAPQVGQRMPNRPWLFANGSARVQLREVAAPRDELALTWNTRYVHKFFLGWESNGRREDKERVRAQLLHSLALTYIAR 816 So...
WP_146654833              739 GTFGAFEGDRIPNRPYFFANGSARVLLRGLASARDELSFVWNTRWVHEFYRGWESVGAKAYKQVIPAQLTHSAALTYLTR 818 La...
PRJNA294368:SOCE26_046770 758 GPLARFRGDRMLNQPYLFADVSARLQWPEPFHPRDALSLTWSARYVGEFFLGWESAG--ANKLAVASQLLHALALTYVVQ 835 So...
WP_136919895              713 GAFGKFEGDRIPNRPYLFAGGSARVQGSDLLRPRDVLSLTWQSRHVQAYLRGWESVGATDSKLVIPSQLVHALALTYSVK 792 Po...
WP_146730426              726 GAFRQFDGDRIPNRPWLFGSAGARVQIRSLFAKNDELDPFYGMRYVRQFFRGWESQGILESKQTVPSQTTHGVGISYTVR 805 Mi...
WP_074957877              719 GTFGDFDGRRLPNRPWLFANATARMSLRGLALAEDELSPFWSTRYVHGFFRNWEGLGLESTKDDLDAQFVQTAGVGYRVR 798 My...
WP_095960551              715 GTFGAFEGQRLPNRPWLLFNATARLSLRGVATAEDELSPFWTARYVHGFFRNWGGLGAAGTKETIDSQFAQAAGVGYKVR 794 Co...
WP_108065768              708 GTFGAFDGDRLPNRPWFFANATARMSVRELLAARDELSPFWSARYIHEFVRGWESAGAQSTKDVIPSQFVQTAGVGYRVS 787 Vi...
WP_044181810              711 GTFGAFDGDRLPNRPWFFANGTARMSIRGVVAEQDELSPFWSTRYIREFFRHWESVGAAETKEVIPNQFVQSAGVSYRVT 790 Hy...
WP_074958595              736 GQFARFKGDRMPNMPWLQATGTARFQVSRLLSREDALGLEWTTRVVGSFDRSWESAGNGGTKHSVPTQVLHSTALTYRAR 815 My...
KYF66359                  817 LAPRTLSFTVEAHNLTDELAFDFYGVQRPGRALFSKVMLEM 857 Sorangium cellulosum
WP_146654833              819 PGDLVLTFTAEAQNITDRQVFDFFGVQRPGRAFYVKTTLEF 859 Labilithrix luteola
PRJNA294368:SOCE26_046770 836 SGGYSVSGSLEVQNLTDEKASDFYGAQRPGRAAYAKLVLEL 876 Sorangium cellulosum
WP_136919895              793 HGDGSVSGTIEMQNLTDEKVFDSFGVQLPGRAAHAKLVLEL 833 Polyangium sp. SDU3-1
WP_146730426              806 -GRANITSTIEVQNLTNALVFDVFGVQKPGRSVFWKVVAEI 845 Minicystis rosea
WP_074957877              799 RGKLTVGLTAELENLTDARVFDYYGVERPGRAGWLKGTLEY 839 Myxococcus fulvus
WP_095960551              795 LNGFSLGLSTELDNLTDARLFDFFGVQRPGRSGWLKATVEY 835 Corallococcus macrosporus
WP_108065768              788 LGERVMGLTAEVENLGDARNYDFFGVQRPGRSFWLKGTFEY 828 Vitiosangium sp. GDMCC 1.1324
WP_044181810              791 RAQATVGLTAELENLGNARTFDFFGVQRPGRAAWLKGTFEY 831 Hyalangium minutum
WP_074958595              816 FERRAYSFSFNLHNLTDAAAFDLVGVQRPGRALSARLTVDL 856 Myxococcus fulvus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap