Conserved Protein Domain Family
NRPS_MxcG

?
NF038078: NRPS_MxcG 
myxochelin non-ribosomal peptide synthetase MxcG
Statistics
?
PSSM-Id: 468336
Aligned: 16 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012236518    5 QDARWPLSAAQHGIWLGQQLDPASPVYNAGECVEICGALDLATLEAAIRQAASEAEALHVRFTSEADGPRQRLDLSPDFP 84   Sorangium cel...
WP_164021050    5 QPAGWPLSAAQHGIWVGQQFDLKSPVYNAGECIEIRGAVDVAHFESALRQALGEAEALHSRFVSGASGPVQSVEPRADWP 84   Pyxidicoccus ...
WP_140875421    5 HEAGWPLSAAQHGIWVGQQFDLTSAVYNAGECIEIRGPLVVEHFESALRQAIDEAEALHARFVPGASGPVQFVQPRASWQ 84   Myxococcus xa...
WP_141646966    5 HDARWPLTAAQHGIWVGQQLDLASPIYNAGECIELRGAIVPEHFEAAVRQTVDEAEALHARFESTQEGSSQQVSPRVEWA 84   Myxococcus ll...
AAG31130        5 QETRRPLSAAQHGIWLGQQFDLKSPVYNAGECIEICGPVDPALFEAAVRQAVREAEALHVRFVASEEGPQQLLGLQTDWV 84  
WP_073564958    5 QNVRWPLSAAQHGIWLGQQFDRTSPVYNAGECIEIRGPVDPALFEAAVRQAVSEAEVLHARFVTEGERPVQLLEPRQDWT 84   Archangium sp...
WP_121710717    4 SQDNRPLTAAQHGIWVGQQLDLKSPVYNAGECIEFRGAVDPVRFESALRKAVADADALHSRFVAGEEGPAQRIDAGTDWT 83   Corallococcus...
WP_120208191    5 AQTGLPLSAAQQGIWVGQQLDVRSPIYNAGECIEVRGPLDIEHFESALQQALGEAEALHARFSGHPEGTRQHLLPRAAVM 84   Corallococcus...
WP_129348173    5 REARWPLSAAQHGIWLGQQLDPASPVYNAGECIEILGPVDRAVLEASVRQAVSEAEALHMRFTSEADEPRQILGPSSDWP 84   Sorangium cel...
WP_136928075    5 SNARWPLSAAQHGIWLGQELDPTLPIYNAGECIEIGGAVDPAVFEASLRQAVTEAEALHMRLFVAEDGPRQHLAPSLDWP 84   Polyangium fu...
WP_012236518   85 VHRVDVGAAPDAFTAAEAWMREDLARPVDLARGPLFTEALFTAGPDRLFWYQRAHHIALDGYGFSLIARRVAEIYTARVE 164  Sorangium cel...
WP_164021050   85 LHFADVSGTPDPWAAAHAWMREDLTRTVDLAQGPLFAEALFKAAPDRFFWYQRVHHIALDGFGFSLVARRVADLYTARVT 164  Pyxidicoccus ...
WP_140875421   85 LHVADVSHTPAPWTEAQAWMHEDLTRTVDLGQGPLFAEALFKAAPDRYFWFQRAHHIALDGFGFSLVARRVADLYTARVT 164  Myxococcus xa...
WP_141646966   85 LQHVDVSTEADPWAAAQAWMKEDLTRTVDLTRGPLFAQVLFKAGPERYFWFQRVHHIAMDGYGFSLLTRRVADLYTSRVT 164  Myxococcus ll...
AAG31130       85 LHTADLSESPDPWAAVQAWMKADLAQTVDLSRGPLFTEALFKAAPDRFFWYQRIHHIAMDGFGFSLLARRVAEVYTALAA 164 
WP_073564958   85 LHVADLSGTPDPWEAARSWMRDDLARPVELSQGPLFAQALFKAAPDRFFWYQRAHHIALDGFGFSLMARRVAELYTARAA 164  Archangium sp...
WP_121710717   84 LQHVDLSGEADPWAATQEWMWKDLGRTVDLGTGPLFAQALLTVGPERSFWFQRIHHIAMDGYGFSLLARRVAELYTAEVT 163  Corallococcus...
WP_120208191   85 LRRVDLRGATDAWATALDWMNRDLLQTVDLSEGPLFATALLQAAPDRFFWFLRVHHIALDGFGFSLLTRRVADLYTARRT 164  Corallococcus...
WP_129348173   85 VHHVDVSAAPDPWAAALAWMREDLDKTVDLGRGPLFAEALFTAGPDRTFWYQRAHHVALDGYGFSLIARRVADLYTVRIQ 164  Sorangium cel...
WP_136928075   85 LHRIDVACEADPWILVDAWMRADLGTTVDLRRGPLFTEALFTAGADRTYWYQRAHHIALDGFGFSLIARRVAELYTARIE 164  Polyangium fu...
WP_012236518  165 GRSSEGGaFGSLRRVVDEDLAYRASPDLERDRAFWTQRFADRPEPVSLGDePAPASRACLRRTASLAPSTVDRLKDVARQ 244  Sorangium cel...
WP_164021050  165 GRPATGG-FGPLRPVLEEDAAYRAGAQVEADRAFWVGRFEKGPTPVSIAE-PAPMSSTFVRQMQHLSPAEVERMQVTARQ 242  Pyxidicoccus ...
WP_140875421  165 GKPATNG-FGSLRAVLDEDAAYQGGAQHAADRAFWVERFTHGPTPVTLAE-PAQMSPRFVRQTRHLSPADLERMQAAAKQ 242  Myxococcus xa...
WP_141646966  165 GKAAPAG-FGPLRPVLDEDAAYRAGPQFQKDRDFWVGRLADAPLPVTLAP-PAPMSASFVRSTRMLAGTDVERMQAVAKQ 242  Myxococcus ll...
AAG31130      165 GRPITGG-FGSFQAVLDEDVAYRNGPQHELDRTFWTERFADRPTPVSLAS-PAPMSPSFVRQTRFLPAQSMERLQAVSRP 242 
WP_073564958  165 GRPVTGG-FGPLRAVLDEDAAYRAGPQFELDRTFWTERFADRPTPVGLAE-PAPMSASFVRQTRHLSPGDMERLQAAARQ 242  Archangium sp...
WP_121710717  164 GKAAPAG-FNRLGPVMEEDVAYRCGAQIQKDRDFWVNRFEDAPVPPLLAE-AAPMSSRFLRRSEYLRPELMTALQAGAKQ 241  Corallococcus...
WP_120208191  165 GRAASGG-FGALRGVLDEDLAYQSSAQREADRAFWMERFADGLTPVTLTP-PAPMSAAFIRRTHHLSTSEVERLQALSRR 242  Corallococcus...
WP_129348173  165 DRPCGDSaFGPLRRVVEEDLAYRASPALERDRAFWSRRFADRPEPVSLTDrPAPMSRTFLRQTASLSPACMDSLRATARR 244  Sorangium cel...
WP_136928075  165 GRTNTGApFGSLLRVVEEDLAYRASPAYERDRAFWTQRFADRPVPVSLGVrSAMASRSALRKTTSLSPATMERMQVVARS 244  Polyangium fu...
WP_012236518  245 AKA--TWPDVVIAATAAYVHRLTGAPEIVLGLPVMGRLGSVSLRIPGMVMNIVPLRVPVAEGASLADVARQVASELAAIR 322  Sorangium cel...
WP_164021050  243 AGL--GWPDLVLAATAVWLHRLTEAREVVLGLPVMSRLGSVALKVPCMAMNIVPLHVSVKPEAGLLTMARDVAAEVRAMR 320  Pyxidicoccus ...
WP_140875421  243 AGL--TWPDLVLAATAAWLHQHTGAPEVVLGLPVMTRLGSAAIRVPCMAMNIVPLRVPVRPDAGLFAMARDVAAELRAMR 320  Myxococcus xa...
WP_141646966  243 LGL--TWPDLVLAATAAWIHLRTDAPEVVLGLPVMTRLGSAALRVPCMAMNIVPLRVPVSPGATLASLARHVAAEMRASR 320  Myxococcus ll...
AAG31130      243 AGL--NWPDLVLAATAVYLHRLTDATEVVLGLPVMTRLGSAALRVPCMAMNIVPLRVPVSPEASLLDLARGIAAEVRAMR 320 
WP_073564958  243 AGL--AWSDLVLAATAAWLHRRTDAPEVVLGLPVMSRLGSAALRVPCMAMNIVPLRIPVRPGTGLIDLAREVASELRTVR 320  Archangium sp...
WP_121710717  242 AGV--SWSDLVLAVTAIYLHQRTGAPEAVLGLPVMGRLGSASLRVPCMAMNIVPLRIAVRPDAGLYALARDVAAEMKASR 319  Corallococcus...
WP_120208191  243 EGL--SWPDLLLATAAAWMHRETTSTEVVLGLPVMARLGSAALRVPCMAMNIVPLRVKVRPEEGLLDLARGVAHEVRAAR 320  Corallococcus...
WP_129348173  245 AGAgaSWPDAIVAATAAYLSRLAGAPEVVLGLPVMGRLGSASLRVPSMVMNIVPLRVPVRPGASLTELTRLVAEEVRAIR 324  Sorangium cel...
WP_136928075  245 AGA--SWPDVIVAAIAAYTNAMTGAPEIVLGLPVMGRLGSVSLRIPSMVMNIVPLRVPVAKGTSLSALVKTVADEMRAIR 322  Polyangium fu...
WP_012236518  323 PHLRYRYEQLRRDLKLIGGGRRLFGPVVNIMPFDYDLRFAGHRGVAHNISAGPVEDLSFGVYARSDGRGPRLDLDANPAC 402  Sorangium cel...
WP_164021050  321 PHLRYRYEQLRRDLRRVGGQRKLFGPVVNLMPFDYALRFAGMPAVAHNLSAGPVEDLSIGMYARSDGSGMRVDFDANPAC 400  Pyxidicoccus ...
WP_140875421  321 PHLRYRYEQLRRDLKRVGGQRRLFGPVVNIMPFDYALRFAGMPAFAHNLSAGPVEDLSIGMYARSDGSGLRVDFDANPAC 400  Myxococcus xa...
WP_141646966  321 PHLRYRYEQLRRDLRRVGGQRKLFGPVVNIMPFDYGVRFAGLPGIAHNISAGPVEDLSIGMYARSDGGGLRVDFDANPVC 400  Myxococcus ll...
AAG31130      321 PHLRYRYEQLRRDLKLVGGQRRLFGPVVNIMPFDYALRFAGMPTIAHNISAGPVEDLSIGLYARADGKGLRVDFDANPAC 400 
WP_073564958  321 PHLRYRYEQLRRDLRLVGGQRRLFGPVVNIMPFDYALRFAGMPAIAHNLSAGPVEDLSIGLYARSDGGGPRIDFDANPAC 400  Archangium sp...
WP_121710717  320 PHLRYRYEQLRRDLRLVGGQRKLFGPVVNIMPFDYALDFAGVPGTAHNISAGPVEDLSFGFHARSGGTALRVDLDANPAC 399  Corallococcus...
WP_120208191  321 PHLRYRYEQLRRDLRRVGGQRRLFGPVVNIMPFDYGLRFDGIPAIAHNVSAGPVEDLSIGVYARSDGGGLRVDFDANPAC 400  Corallococcus...
WP_129348173  325 PHLRYRYEQLRRDLRRIGGEKRLFGPVVNIMPFDYDLRFAGQRAIAHNLSAGPVEDLSIGVYARSDGRGPRVDLDANPAC 404  Sorangium cel...
WP_136928075  323 PHLRYRYEQLRRDLKLLGGDRRLFGPVVNIMPFDYDLRFAGHRAIAHNISAGPVEDIAMNVYARSDGRGPRVDFDANPDC 402  Polyangium fu...
WP_012236518  403 YGDDDLSAHQRRFLAFLEAVAEAPEQALDRAEIDLPRAAAraPGAQavateQPGALLDGGPLPAPARPVVEQIALRARER 482  Sorangium cel...
WP_164021050  401 YRPNELRAHQRGFLQLLESLVAEPELPVGSMLPGRGRASPvaEALPn----LAACLLDGGPLPAPARPVLELLTERAREQ 476  Pyxidicoccus ...
WP_140875421  401 YSPDVLDAHQQGFLQLLESLLAAPEQAVRVAPAP---------ARP--------SIADGGPLPIPQRPVLKLFKEQARAR 463  Myxococcus xa...
WP_141646966  401 YDARAVDSHQQEFLRHLDTWLGAPEQAVREQ---VLSTGG------------DASVLDGGPLPAPAHPVLELIERQSREQ 465  Myxococcus ll...
AAG31130      401 YEAKALESHPSAFLELLEALTAAPDQAVG----RDSGSL---SSSSsk-apSLASVLDGGPLPVAAQPVLQLIAERALEQ 472 
WP_073564958  401 YSADTLDSHQREFLQFLESCVAAPEKAVGRSSP-------------------LSSILDGGPLPVPARPVLNLITEQAHEQ 461  Archangium sp...
WP_121710717  400 YTEAALEEHQRGFLQLLESLLAQPEQPVRR-----SASGA------------PGSVLDGGPVP-PVRPVLELLKAQADVR 461  Corallococcus...
WP_120208191  401 YREETLAAHQREFLQLLEDLVTQPHRPSAPAPKPp----------------GPLSLLDGGPLPSAPRAAIACITEQARLH 464  Corallococcus...
WP_129348173  405 YGAEELAAHKERLLALLAALAAAPDQAVDDAALDDRPGAGapPPAR-------GALLDGGPLPAPARAVVEQFAERARER 477  Sorangium cel...
WP_136928075  403 YSAEELATHQQRFLDFLEAALSAPAQPLAEFTIPGAAAPStsTAES-----RPGEILDGGPLNAPPRDIVEQILEHARAK 477  Polyangium fu...
WP_012236518  483 PDATAIQHGLERVTYGELDLAARRLAARLAALGAGPDTLVAVLLPRSVGAITAILGALYAGAGYLPLDPDGPQPRTTAIL 562  Sorangium cel...
WP_164021050  477 PEAIAVEHGPYRLSYRELLESASVLAKQLVSEGVRPDTAVAVMLPRSLDAIVAAWGVLLAGAGYLPIDPFGPSSRTAAIL 556  Pyxidicoccus ...
WP_140875421  464 PDAVAVEHGEHRLTYASLLQSAQALAEQLRADGARPDTLVAVSLPRSIDAIVATLGVLFSGAGYLPVDPFGPESRTKAIL 543  Myxococcus xa...
WP_141646966  466 PDVIAVEHGEHRLTYGELWRAAGSLAERLVAEGVQSDTPVAVKVPRGIDAIVASLGILRSGAGYLPLDPTGPASRSAAIL 545  Myxococcus ll...
AAG31130      473 PDAIAVEHGQHQMSYRELLQSAQALSAQLISAGVQPNTAVAVMLPRGLDAIVASLGVLFSGAGYLPLDPYGPSSRTAAIL 552 
WP_073564958  462 PDAIAVEHGPHRLSYRELIEASHALAGRLVAAGVQADTPVAVMVPRGIDAIVASLGVLFSGAGYLPIDPFGPSSRTTAIL 541  Archangium sp...
WP_121710717  462 PDAVALEHGRWRMTYRELVTASQALASRLIEAGVRPDTAVAVKVPRGIDAIVSCLGILFAGAGYLPIDPTGPATRNAAIL 541  Corallococcus...
WP_120208191  465 PDAIAVEHGPYSLTYEALLTAASDIASQLVAAGARPDTPVAVMVPRSLDAITAVLGVLLAGAGYLPIDPFGPATRTAAIL 544  Corallococcus...
WP_129348173  478 PAAIAVEHGPRRATYGELERAARALAARLAARGAGPDTLVAVLLPRSVDAITAILGVLLSGAGYLPLDPAGPGSRTAAIL 557  Sorangium cel...
WP_136928075  478 PDAVALEHEGRRMTYGELVLAAQRLAARLVALGAGPGTLVALMLPRSVEAITAILATLFSGAGYLPLDPKGPNSRTAAIL 557  Polyangium fu...
WP_012236518  563 DDARPAIIVTTSPHAAKVG----SDRAARLVLLDEAIhg--------------------aPARALVQGAEEHLAYVIYTS 618  Sorangium cel...
WP_164021050  557 ADAAPDLIVTTAGEGPTPGagpqAPGNLLVKRRPGSEp---------------------gASASTSPAGEARLAYVIYTS 615  Pyxidicoccus ...
WP_140875421  544 DDAAPRLTVSSAVKDLTAGmppqAPGQLAVHRRPGP------------------------EQPATAPQPGAPLAYVIYTS 599  Myxococcus xa...
WP_141646966  546 DDAAPSLMVLPSETVSATDasprAAGHLTVLKRDVAA------------------------ETVAPRAEAERLAYVIYTS 601  Myxococcus ll...
AAG31130      553 EDAKPALIIQR----STPDadplSRGNLVIRQNEQAPaa-------------------apSSRTLPQTSGEHLAYVIYTS 609 
WP_073564958  542 EDAAPGLIITS-SQGTTPGagpvAPGHLVVSRNEKAThr-------------------vsGEAP--RKADEQLAYVIYTS 599  Archangium sp...
WP_121710717  542 QDARPAVMVVSE--RPSPDtdptAPGVLVVQRLEQAGtsaldstehaiprvvpaaqrpeaRDAEPASSAEARLAYVIYTS 619  Corallococcus...
WP_120208191  545 ADAEPELILSLLETRLGQAtgplPLGGLVLRRHKVAQp-----------------------RPPSPREADERLAYVIYTS 601  Corallococcus...
WP_129348173  558 DDAAPALLVTTSEHAAQARglleGARATRLVLLDDEPap--------------------aEAPAPAPAADEHLAYVIYTS 617  Sorangium cel...
WP_136928075  558 ADAGPVALVTNSEYAEQAKq---TTTAP-IVRADEDVps--------------------nLPEAPIRGGAEHPAYVIYTS 613  Polyangium fu...
WP_012236518  619 GSTGRPNGVMIERGALAHFVAAATHRYDLRRDDRVLQFAPLHFDASVEEIFLTLCAGAALVLRTDEMLQSVPRLLDACER 698  Sorangium cel...
WP_164021050  616 GSTGQPNGVQIDRDALAHFVVGATQRYGLRSDDRVLQFAPLHFDASVEELSLTLCVGGRLVLRTDEMLQSVPRLLDACAE 695  Pyxidicoccus ...
WP_140875421  600 GSTGQPNGVQIDHDALAHFVAGATFRYEVTSEDRVLQFAPLHFDASVEEIFVSLCAGATLVLRTDEMLQSVPRLLEACAT 679  Myxococcus xa...
WP_141646966  602 GSTGQPNGVQIPHQALAHFVAGATHRYAVTREDRILQFAPLHFDASVEEVFLALTSGARLVLRTDEMLQSVPRLLESCAA 681  Myxococcus ll...
AAG31130      610 GSTGQPNGVQISHEALAHFVAGATHRYGVRRDDRVLQFAPLHFDASVEEIFLTLCAGAKLVLRTEEMLQSVSRLLDACAE 689 
WP_073564958  600 GSTGQPNGVQISRGALAHFVAGATQRYGVNREDRVLQFAPLHFDASVEEIFLTLCAGARLVLRTDEMLQSVPRLLGACAA 679  Archangium sp...
WP_121710717  620 GSTGQPNGVQITHGALAHFVAGATQRYSVGPEDRVLQFAPLHFDASVEEIFVTLCAGGRLVLRTDEMLQSVPRLMEACAE 699  Corallococcus...
WP_120208191  602 GSTGQPNGVEVTQGSLAHFVAGATQRYGVSAKDRVLQFAPLHFDASVEELFLTLCSGARLVLRTDAMLQSVPRLLEACAE 681  Corallococcus...
WP_129348173  618 GSTGRPNGVMVSRGALAHFVAGATRRYDLRRDDRVLQFAPLHFDASVEEIFLTLCAGATLVLRTDEMLQSVPRLLEACAE 697  Sorangium cel...
WP_136928075  614 GSTGRPKGVVISRAALSHFVAGATHGYGFRRDDRVLQFAPLQFDASVEEIFGSLCLGATLVLRTEAMLQSVLRLLDACAE 693  Polyangium fu...
WP_012236518  699 HRITVLDLPTAFWHELAYGLSTGAASLPESVRTVIIGGEAALPERVERFRRAVGRRARLLNTYGPTEATVVASAATLSGG 778  Sorangium cel...
WP_164021050  696 HGITVLDLPTAFWHELAYSVSTGSARLPSSLRTVIIGGEAALPERVARWRTTVGPQVRLLNTYGPTEATVVATVATLSGE 775  Pyxidicoccus ...
WP_140875421  680 HGITLLDLPTAFWHELAYSVSTGAARLPPSLRTVIIGGEAALPERVARWRASAGPQVRLLNTYGPTEATVVATVATLSGG 759  Myxococcus xa...
WP_141646966  682 HGITILDLPTAFWHELAYAVSTGAARLPSSLRTVIIGGEAALPERVARWRATVGPSVQLLNTYGPTEATVVATVASLADA 761  Myxococcus ll...
AAG31130      690 HGITVLDLPTAFWHELAYSVSTGAARLPSSIRLVIIGGEAALPERVARWRSAVSPEVLLLNTYGPTEATVVATTATLSGP 769 
WP_073564958  680 HGITVLDLPTAFWHELAYSVSTDAARLPSSLRLVIIGGEAALPERVARWRAAVGPEVLLLNTYGPTEATVVATAATLSGG 759  Archangium sp...
WP_121710717  700 AGITLLDLPTAFWHELAYSLSTGAARLPDALRTVIIGGEAALPERIARWKDVAGDRVHLLNTYGPTEATVVATVAEIAGP 779  Corallococcus...
WP_120208191  682 RDITVLDLPTAFWHELAYAVSTGAVVLPPSLRTVIIGGEAALPERVARWRDTVPPSVQLLNTYGPTEATVVATCALLGVP 761  Corallococcus...
WP_129348173  698 HGITVLDLPTAFWHELAYSISTGAASLPPGVRTVLIGGEAALPERVARWRAAVGRSARLLNTYGPTEATVVATVATLSGA 777  Sorangium cel...
WP_136928075  694 HAITVLDLPTAFWHEVACSLSTGAASLPPSVRIVIIGGEAALPEHVARFRRAVGPTVKLFNTYGPTEATVVATFATLCGG 773  Polyangium fu...
WP_012236518  779 DAPDeapDDRHEAPIGTPLPGVRAAIIDtrththARGRLAPRGAVGELHLIGPGLARGYLGRPDLDAARFVVLDQLEGRP 858  Sorangium cel...
WP_164021050  776 DAVG---GASDEVPIGRPLPGVCAVLLD------AQGKPVTAGDEGELYLLGGGLARGYLGRPALTAARFTELAALPGQP 846  Pyxidicoccus ...
WP_140875421  760 LDET---PTGDDVPIGRPLPGVRAVIAD------AQGRIVPTGEEGELHLLGGALARGYLGREALTATRFITLDALPGSP 830  Myxococcus xa...
WP_141646966  762 GGPE---SERDEVPIGLPLPGVRAVLVD------AQGRLVARGSEGELCLLGGALARGYLGRPELDKARFISLAALPGQP 832  Myxococcus ll...
AAG31130      770 APAG---TPEEEIPIGRPLPGVRAALID------AQGKLAAPGAEGELYLLGGGLARGYLGRPELNTARFTTLGMLSDRP 840 
WP_073564958  760 TSTA---STNDEVPIGCPLPGVSAAVID------SHGRLAAPGTEGELYLLGGALARGYLGRPERDAARFIPLEALPGSP 830  Archangium sp...
WP_121710717  780 DALP----SGDEVPIGRPLPGVVAAVVT------PQGRLATPGKEGELCLMGGALARGYLGRSELDAARFTRLDAVEGTP 849  Corallococcus...
WP_120208191  762 GSAA----ADPGISIGLPLPGVRVALVD------AHGTVVPRGDEGELYLLGGGLARGYLGRDALTSARFVQLESLPGAP 831  Corallococcus...
WP_129348173  778 GAGDdagDE---VPIGTPLPGVRAALLD------ARGRPVARGAVGELHLIGPALSRGYLGRPELDAARFVRLDQLPGRP 848  Sorangium cel...
WP_136928075  774 ETTAgrdEE---VPIGTPLPGVRAAILD------AEGRLVARGAVGELYLMGGGLATGYLGQPELTASRFPTLEHLPNQP 844  Polyangium fu...
WP_012236518  859 RAYRTGDLVLQRADGQMVFVGRVDDELKISGHRVDPLEIEAALLRHPSVREAAVIGHASAGGGKRLSAFLVAGDPAPSPA 938  Sorangium cel...
WP_164021050  847 RAYRTGDRARLGDDGQLIFVGRVDDEFKLSGHRIDPAEVETVLLGHPRVREAAVVGQVLPGGSRRLCAWLVTDAPEPSVM 926  Pyxidicoccus ...
WP_140875421  831 RAYRTGDKARLREDGQIVFVGRVDDEFKISGHRIDPSEVETALLGHSGVREAAVVGQVLPSGSRRLCAHVVTTQPAPTVA 910  Myxococcus xa...
WP_141646966  833 RAYRTGDKARLREDGQLVFVGRVDDELKISGHRIDPAEVETVLLGHPGVREAAVVGQVLPGGARRLCAHIVAEAPVPSAA 912  Myxococcus ll...
AAG31130      841 RAYRTGDKARVREDGQLVFVGRVDDEFKISGHRIDPTEIETVLLSHSGVREAAVVGQILPGGTRRLCAHIVAEMPVPATA 920 
WP_073564958  831 RAYRTGDKVRLRGDGQLVFAGRVDDEFKISGHRIDPAEVETTLLGHPGVREAAVVGQVLPGGSRRLCAHIVAAEIVPSAA 910  Archangium sp...
WP_121710717  850 RAYRTGDKVRVREDGQLVFVGRVDDEFKISGHRIDPGEVETVLLKYPGIREAAVVGQVLPGGSRRLCAHLVAS-PEPSPA 928  Corallococcus...
WP_120208191  832 RAYRTGDRARMREDGQLVFVGRVDDEFKISGHRIAPAEVESVLLTHPEVQAVAVVGQLLPSGARRLCAQVVAHAPAPTAA 911  Corallococcus...
WP_129348173  849 RAYRTGDLVRARDDGQLVFVGRVDDELKISGHRVDPLEVETALLRHPSVREAAVVGHASPDGSKRLTAFVVAGDPAPPVA 928  Sorangium cel...
WP_136928075  845 RAYRTGDLVRQNEDGLLVFIGRVDEELKISGHRVDPGEIETVLLRFPGVREVAVVGSVLPGGIKRLAAHLVADAPLPSPA 924  Polyangium fu...
WP_012236518  939 ELRRHARSLLPAAAVPSAFVLTDRLPRTSSGKIDRKALREApIAAAAEP-PAAATALERQLLQVWEQVLGVSGLSAHDDF 1017 Sorangium cel...
WP_164021050  927 ELRQHVQAALPAPMVPGAFVFRERLPRTSTGKIDRSELRRVsPIEEPAPtSPAATGLEQRVLRVWEQVLGMSGLSAESDF 1006 Pyxidicoccus ...
WP_140875421  911 ELRQHLLDGLPAPMVPGTFVFAERLPRTSTGKLDRAELRRLlPTEEVATtTAGTTALERVVMKVWEEVLGVTTTSAQDDF 990  Myxococcus xa...
WP_141646966  913 DLRKHLLANLPAPMVPGAIVFAERLPRTSTGKIDRAELRKAtTTDASSTvAQATTELERVVLGIWEEVLGATGLTAQDDF 992  Myxococcus ll...
AAG31130      921 ELRRHLLSELPAAMVPSAFVFAEKLPRTSTGKLDRNALRLVqPPEE-ATpTATTTPFERMVLQVWEQVLGLSRITAQDDF 999 
WP_073564958  911 ELRRFLLSELPAPMVPSAFVFTERLPRTSTGKLDRAALRHVsPAGESASvTTAATELERVVLNAWEQVLGVSGVSAQDDF 990  Archangium sp...
WP_121710717  929 ELRKHLLTALPAPMVPGAFSFAERLPRTSTGKIDRKALQNAmPADESAAlLASATPMERTVLEVWEQVLGRAASSLQDDF 1008 Corallococcus...
WP_120208191  912 ALRDHVRARLPAPMVPGALVFVESLPRTSTGKIDRAALLRAfPVED-PTfTEETTAMERRVLEVWEQVLGMRGASPRDDF 990  Corallococcus...
WP_129348173  929 DLRRHARSLLPAAAVPTAFVLTDRLERTSSGKIDRAALRKApIAAAASTtAAGATALEQAVLRVWEQVLGVSDLSTHDDF 1008 Sorangium cel...
WP_136928075  925 ALRQHAQSALAPASIPSAFLFTDRLPRTSTGKIDRAALRDAg-ATRTAAsNAPATDLEKIVMGVWEQILGVCDLSVEDDF 1003 Polyangium fu...
WP_012236518 1018 FERGGQSLQTIQVANRLSVDLGREIPVAMVFRHPTVAALARALDEAQGaaaAAQTSGEPPGAMLADAELPEDVVP----- 1092 Sorangium cel...
WP_164021050 1007 FDLGGQSLQSIQVANRLGVELGREVPVATVFRHPTAAALARALEHGPD---VATEAGGLTAAMLADAELPEDLVP----- 1078 Pyxidicoccus ...
WP_140875421  991 FDLGGQSLQSIQVANRLSIELGREIPVATVFRYPTAAGLAQALEQGTD---GASDAGGLTESMLADAVLSDDVVP----- 1062 Myxococcus xa...
WP_141646966  993 FDRGGQSLQSIQVANRLGIALGREVPVATVFRYPTAAALAQALEHGEA---TGSEASGPSTTMLADAELSEDIVPrpstt 1069 Myxococcus ll...
AAG31130     1000 FELGGQSLQTIQVANRLSVALGRDVPVATVFRYPTAAGLAQALEHGEQ---HSVEGEGISKAMLADAELPEEIVPrlptp 1076
WP_073564958  991 FELGGQSLQGIQVANRLGVALGREVPVATVFRYPTAAALAQALERGAE---SGSDGGGLTPAMLVDAELPEEIVPr---- 1063 Archangium sp...
WP_121710717 1009 FELGGQSLQSIQVANRLGIAVGRDVPVATVFKHPTVSGLAQALQGGST---GGAETGGLTPAMLADAELGEDIVPptt-- 1083 Corallococcus...
WP_120208191  991 FDLGGQSLQSIQVANRLSILLGREVPVSTVFRHPTAAALAMALEHGES---NAPRAAGLPASLLADAALPEDIVP----- 1062 Corallococcus...
WP_129348173 1009 FERGGQSLQTIQVANRLSVELGREIPVAMVFRHPTVAELAGALDPSAS----AAARGGPHDAMLADAELPEDVVP----- 1079 Sorangium cel...
WP_136928075 1004 FERGGQSLQTIQVATRLGVTLGREIPVAMVFRHPTIAELSRALEQAGS---VTKASAGLTEAMLADAVLPEDIVP----- 1075 Polyangium fu...
WP_012236518 1093 ----RSLVWSGGGGRPRQIVLTGASGFVGAHLLHELLAQTDATVVCLVRAESEAHAAERIRQALSKQRLPVGGIDARVLA 1168 Sorangium cel...
WP_164021050 1079 ----PLQTTGALPAWLRQVVLTGATGFVGAHLLDQLLRQTEARVVCLVRASDEAHAMERLREALASQHLSTASLSERVVA 1154 Pyxidicoccus ...
WP_140875421 1063 ----KLTVQAAESPRLRQVVLTGATGFVGAHLLHQLLRQTDARVVCLVRARDEAHALERIQAALASQQLSPEHLTERVVA 1138 Myxococcus xa...
WP_141646966 1070 apqgVGGSFETRFPEPRQVLLTGATGFVGAHLLDQLLRQTRARVVCLVRASDEAQAMERIRAALSSQQLPTSGLAERVLA 1149 Myxococcus ll...
AAG31130     1077 gaeaPLAPSPGPAAPLRQVLLTGATGFVGAHLLDQLLRQTQAKVVCLVRARDEAHAMERLREAMTSQRLSTASLSERVLA 1156
WP_073564958 1064 ---qVGKGQGTDAREPRQVLLTGATGFVGAYLLDQLLRQTDARVVCPVRARDEAHAMERIRAAMKAWRLPDTGLAERVLA 1140 Archangium sp...
WP_121710717 1084 -geaWARELPSQGNGYRQVLLTGATGFVGAHLLHQLLTRTDARIICPVRAKDEAQAMERLRSALTGQKLPLTGLEARVLA 1162 Corallococcus...
WP_120208191 1063 ------AQPTATSGPPRCILLTGASGFVGAHLLNQLLQRTDARILCPVRARDTSHAMERLQAGLTAQRLVPRGLHARVVA 1136 Corallococcus...
WP_129348173 1080 ----RSLAPSGSPPRLQKVVLTGASGFVGAHLLHELLTQTDARVVCLVRAESEAHAAARIQRALQDQRLPAADLASRVVA 1155 Sorangium cel...
WP_136928075 1076 ----PAP--AAMPSSPRQVVLTGATGFVGVHLLHALLQRTTARVVCLVRAADEKRAADRLRTALEKQHLPTTHFEDRVVA 1149 Polyangium fu...
WP_012236518 1169 VPADLTQPRLGLSAARFGQLAAECDAIYHNAAVVSLVRDYRSLRAANVIGTREALRLAAAVRPKPLHHVSTLAVAPGIAA 1248 Sorangium cel...
WP_164021050 1155 LPADLTQPWLGLGSARFHGLASECDAVFHNAAVVSVVREYGSLQAVNVRGTRELLRLAAAVRPKPFHYVSTLAVAPQANL 1234 Pyxidicoccus ...
WP_140875421 1139 LPSDLTQPWLGLSQARFHGLASECDAVIHNAAVVSVVREYGSLQAVNVRGTRELLRLAAAVRAKPFHYVSTLAVAPQTDL 1218 Myxococcus xa...
WP_141646966 1150 LPSDLTQPMLGLDSARFHGLAAECDVILHNAAVVSVVREYGSVQAVNVKGTRELLRLAAAVRLKPFHYVSTLAVAPQANV 1229 Myxococcus ll...
AAG31130     1157 LPADLGQPWLGLSSARFHGLAAECDMILHNAAVVSVVREYGSLQATNVRGTRELLRLAASVRPKPLHYVSTLAVAPQANL 1236
WP_073564958 1141 LPADLTQPWLGLGSARFHGLAAECDAIYHNAAVVSVVREYGSLRAVNVQGTRELLRLAAAVRPKPLHYVSTLAVAPPANL 1220 Archangium sp...
WP_121710717 1163 LPADLSQPLLGLDSTRFHGLAAECDAVIHNAAVVSVVREYGSLQGVNVRGTRELLKLAAAVRPKPFHYVSTLAVAPQANL 1242 Corallococcus...
WP_120208191 1137 LPADLTQPHLGLERSRFDALAQECDAILHNAAVVSVVREYSSLQAANVRGTRELLRLAVTGRTKPFHHVSTLAVAPPRDL 1216 Corallococcus...
WP_129348173 1156 VPADLALPLCGLSAARFDELARGSDAIYHDAAVVSVVRDYRSLRAANVLGTREVLRLAAAARPKPLHHVSTLAVAPSVAA 1235 Sorangium cel...
WP_136928075 1150 MPADLALPRLGLGEETWNRLASESDAIYHDAAIVSLVRDYRSMRAVNVLGTREVLRLATTARPKPVHHVSTLAVAPSIAK 1229 Polyangium fu...
WP_012236518 1249 SPEVAEEFVPPHPGLRDGYQQSKWAAERLVQQAAERGLPVAVYRLGRVVGAPDAGVVNEQDLVFRLLRAGIPAGVLPDLD 1328 Sorangium cel...
WP_164021050 1235 LPEVPEEFVPAHPGLRDGYQQSKWVAERLVQQAGARGLPVAVYRLGRVVGAPDSGIVNPQDLVWRILLAGIPVGTLPQLD 1314 Pyxidicoccus ...
WP_140875421 1219 SPDVPEAFVPAHPGLRDGYQQSKWIAERLVEQAGARGLPVAVYRLGRVVGAPDSAIVNPQDLVWRILLAGIPVGALPQLD 1298 Myxococcus xa...
WP_141646966 1230 SPEVPEDFVQAHPGLRDGYQQSKWVAERLVQHASERGLPVAVYRLGRVVGATDTAIVNPQDLVWRILLAGIPSGSLPLLD 1309 Myxococcus ll...
AAG31130     1237 SPEVPEAFVPAHPGLRDGYQQSKWAAERLVEQASERGLPVTVYRLGRVSGALDSGIVNPQDLVWRILLAGIPAGALPQLD 1316
WP_073564958 1221 APEVPEEFVPAHAGLRDGYQQSKWIAERLVQQAAERGLPVSVYRLGRVVGAPGTGTINPQDLVWRILLAGIPAGALPQLD 1300 Archangium sp...
WP_121710717 1243 SPDVPEAFVPSHPGLRDGYQQSKWIAERLVQQASERGLPATVYRLGRVVGAPDTALINTQDLVWRIVLAGLPVRALPLLD 1322 Corallococcus...
WP_120208191 1217 HPEVPEAFVPAHEGLRDGYQQSKWVAERLVEQAGARGLPVNVYRLGRVVGAPDTALVNPQDLVWRILLAGIPVGALPQLD 1296 Corallococcus...
WP_129348173 1236 SPEVPEAFVPPHPGLSDGYQQSKWAAERLVQQAGERGLPVAVYRLGRVVGAPGAGLVNEQDLVFRLLRAGIPAGLLPDLD 1315 Sorangium cel...
WP_136928075 1230 NPEVHETFVAAHPELGDGYKQSKWIAERLVEQAGERGLPVAVYRLGRVVGAPETGVVNEQDLVFRLILAGIPKATLPDLD 1309 Polyangium fu...
WP_012236518 1329 VREVWTPVDYVGRAIVHLSLTAQATGaVVNVAPAPEVRLTELFDWARDYGYPVERRPVAAWRARLKD-GADAADSATLAF 1407 Sorangium cel...
WP_164021050 1315 VGEAWTPVDFVARALVHLSRGASPGT-VFNLTPTADVRLGELFRQVQDYGYPVEMLPVGAWRARVAErAGGGDHDTTLAF 1393 Pyxidicoccus ...
WP_140875421 1299 VAEVWTPVDYVAGAIVRMARDARPPT-VFNLCPTPEVKLRELFAWVRDYGYPVEHCPVGEWRNRVAErAGTGENQSTLAF 1377 Myxococcus xa...
WP_141646966 1310 VGETWTPVDYVARAIVKLSRVATPGT-VFNVTPVPDVRLPDLFRWVREYGYPVDLLPIPAWRARVAErAGTADNTTTLAF 1388 Myxococcus ll...
AAG31130     1317 VGEVWTPVDYVARALVRLSLVPRPGT-VFNLTPAPEVRLSEVFGWVQDYGYPVALCPVPEWRTRVAQsTGSAENSTTLAF 1395
WP_073564958 1301 VSEAWTPVDYVARALVRLSLVPQPGA-VFNLTPAPEVRLSELFRQVRDYGYPVDLLPVPEWCTRVAEsKDGAAHKATLAF 1379 Archangium sp...
WP_121710717 1323 VGEVWTPVDFVASAIVQLSLASHPGA-VFNVTPAAEVRLSELFGWVRDYGYPLDLCHVPEWRDRVAK--GSGGHDATLAF 1399 Corallococcus...
WP_120208191 1297 LGETWTPVDYVAKAVVQLVHEPRPGT-VFNLAPMPEVRLPELFTWVREFGYPIELCSVPEWSARVAKhSRSPEHDSTLAF 1375 Corallococcus...
WP_129348173 1316 VREVWTPVDYVARAIVRLSLAEPARGaVYNVAPGPEVRLAEIFGWARDYGYPVERCPVPIFRARLRD-RADAADSATLAF 1394 Sorangium cel...
WP_136928075 1310 VSETWTPVDYVARAIVELSLPVPSRDaVYNLAPAPDVRLKDVFRWVHEYGYAVETCSVPAFRARLGS-NAGAAESATLAF 1388 Polyangium fu...
WP_012236518 1408 FDLQSApaDGEATFGIGRVRCDNLERGLAGTGITCPPIDRALLHRYLDRCVEEGLLPPP 1466 Sorangium cellulosum
WP_164021050 1394 FDLRSG--SAEPAFGLGPVRCERVLQGLAGTGISCPPTDRALLYRYLDYCVAQGLLPPP 1450 Pyxidicoccus trucidator
WP_140875421 1378 FDLRSG--TDVPAFGLGPIRCERVHQALEGTGITCPPTDRALLYRYLDYCIARGLLPPV 1434 Myxococcus xanthus
WP_141646966 1389 FDLRSG--DSAPAFGLGPIRCQRLHEALEGTGITCPQADRDLFFRYLAWCVTRGLLPAT 1445 Myxococcus llanfairpwllgwyngyllgog...
AAG31130     1396 FDLRAG--AAEPTFGLGTIRSERVLQALSDTGISCPRTDRPLLHRYLDYCVGQGLLQRP 1452
WP_073564958 1380 FELRSG--SSEPTFGLGPTRCERLTRALAGTGISCPPADRQLLFRYLDSCVEQGLLPAP 1436 Archangium sp. Cb G35
WP_121710717 1400 FDLRSG--DSTPAFGLGPIRCERLLAALEASGVRCPPTDRNLLYRYLDSCVAQGILPPK 1456 Corallococcus sp. AB045
WP_120208191 1376 FDLRSG--DERPALGWGAIRAEQLLAALAKTDITCPPADRALLHRYLDTCVAQGLLLPP 1432 Corallococcus sp. H22C18031201
WP_129348173 1395 FDLQPGatGGEATFGLGRVRCDNVTRGLAGSGVVCPPIDRALLHRYLDHCVERGLLPRP 1453 Sorangium cellulosum
WP_136928075 1389 FDLQADpgEQPQAFGLGRVRCDNVIRGLSGSGIDCPAIDRSLVFRYLDHCVETGKLPRP 1447 Polyangium fumosum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap